KEGG   Psychrobacter cryohalolentis: Pcryo_1292Help
Entry
Pcryo_1292        CDS       T00350                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pcryo_1292
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pcryo_1292
DNA repair and recombination proteins [BR:pcr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pcryo_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD Herpes_Helicase AAA_22 DUF2075 UvrD-helicase PhoH UvrD_C DUF3902 AAA_16 AAA_28 ResIII AAA
Motif
Other DBs
NCBI-ProteinID: ABE75073
UniProt: Q1QB80
Position
1576727..1578922
Genome map
AA seq 731 aa AA seqDB search
MSNNNNKSRAGVSLQESWASNISDYILLRRQQTHLAYNVTEAKANADSKQIDKTEQNGLF
TALFVMLATHLEEGHTVLTIEAAEHEHPIQGQINGELVTLYAWQQQLLEMLATPILALID
IQTVTQQEDDSTAGLSLFILLDIMFGKRAQLWAQLALTNREKEILSKRFDAVAALYQIVK
NTNLNSFIQSIHEHTLFADANSNVNNKNSLSKNNQPIVYQHINEPEADTQNIKITFWLHR
AWQAEFNLAQHINTILNQQITPLEIAIPENLHEQQVMAINVANNNAFSIITGGPGTGKTY
TVAQLVIALQQAAESGGDEHGKIRFSTDSASLALAAPTGKAAQRMQESLQAALDGSNVEL
QLQEAKTIHRLLGIGRTGRPRYNANNPLGEDIIIVDEASMLGVELANYLVSAVKPGARLI
LLGDANQLAAVDAGAVLADLCCIPLLQPIHAKLTESRRFSADSGIGKLANQINKTEADTQ
AIWQLLRQDKALSFQYVNTLQTEIAIDNKIKNSLSNYKILSNLTLSYHQYLNRVESLLKN
PIEKSVPELVKSTITSLMQTFNQFRVLSAGHNGEWGDHYINNHITQWHLTKLKLPLGQNT
WFHGRPVMVLQNNYELGLFNGDIGFCLQTGDGRSRLEVFFENKAQGIAVNLLNEDVIATA
YAMTIHKSQGSEFDHVAITFDNSHARLLSKELIYTAVTRAKKQVTIYSTKHAFEKAVQTP
TERNTGLALQF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataataacaataagagcagagcgggcgttagcttacaagaaagctgggctagt
aacatcagtgattatatattgctgcgccgtcagcaaacgcacttagcgtataacgtcact
gaggcaaaggctaatgctgatagtaagcaaatcgataagacggaacaaaatggcttattt
actgctttattcgttatgttggccactcatttagaagagggacatactgtactcaccatt
gaggcagctgagcatgaacatccaatacaaggtcaaatcaatggcgagctagtcacccta
tatgcctggcagcagcaactattagagatgctagcaacaccaatcctagcactgattgac
attcaaacagttactcagcaagaggatgattctacagctgggttatcattatttatcctg
ctagacatcatgtttggtaagcgagctcagctatgggcacagctagcactcaccaatcgt
gaaaaagagatactcagcaaacgctttgatgcggttgctgcactttatcagatagtgaaa
aacacgaatctgaattccttcattcagtctattcatgagcatactttgttcgctgacgct
aattctaacgtgaataataaaaatagcctaagcaaaaataatcaacctattgtgtatcag
catattaatgaaccagaagctgatacacaaaatattaagatcactttttggttacatcga
gcttggcaagcagaattcaacttagcacagcacatcaatactattttgaaccaacagata
acccctttagagatagcgataccggaaaacctacatgagcagcaggtaatggctattaat
gtcgctaataacaatgcctttagcattattactggtggtcccggtacagggaagacctat
acggttgctcaattagtaattgctctgcaacaagctgcagagagtgggggtgatgagcat
ggaaaaattcggttcagtacagacagtgccagcctagccttagcagcaccgactggtaag
gctgcccagcgaatgcaagagtctttgcaagcggctctagatggatcgaatgtagagcta
caactgcaagaagccaagaccattcatcgcttattaggcattggtcgaacaggtagacca
cgttacaatgcaaataatccactcggcgaagatattatcattgtcgatgaggcatctatg
ttgggggtggaactggctaattaccttgtaagtgcggtaaaaccgggcgcaaggcttata
ttgttaggagatgcgaaccagctagccgcagtagatgctggggcagtattggctgactta
tgctgcattccattgctacaacctatacatgcaaagctaacagagagtcgccgatttagc
gcagactcagggattgggaagcttgccaatcaaattaataagacagaggcagatactcaa
gctatttggcagttgttaaggcaggacaaggcactgagttttcaatatgtaaatacgttg
caaacagagatagctatagataataagataaaaaatagcctaagcaattataaaattctc
tcgaacctcactttaagttatcatcaatacctgaatagagttgaatcactactaaagaat
ccaatagaaaaatccgtgccagaattagtaaaaagtacaattacttcattaatgcaaacg
tttaatcagtttagagtcctaagtgctggtcataatggcgagtggggtgatcactacatt
aataatcatatcactcaatggcatcttactaagctaaagctaccgctaggtcaaaataca
tggtttcatggtcgtcccgttatggttttacaaaacaactatgaacttggattatttaat
ggcgatattggtttttgcttgcaaacaggagatggaagaagccgacttgaggtgttcttt
gagaataaagcacagggaattgctgtcaatctgctaaatgaagacgttatagccacagca
tatgcaatgaccattcataaatcgcaggggtctgagtttgatcatgtggccattactttt
gataatagtcatgcaaggcttttgagcaaagagcttatttatacggcggtaacccgtgct
aaaaaacaggtgacaatatatagtacaaaacatgctttcgaaaaagccgttcagacaccg
actgagcgcaatacgggtttggcattgcagttttag

DBGET integrated database retrieval system