KEGG   Psychrobacter cryohalolentis: Pcryo_1594Help
Entry
Pcryo_1594        CDS       T00350                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00072  Synthesis and degradation of ketone bodies
pcr00280  Valine, leucine and isoleucine degradation
pcr00650  Butanoate metabolism
pcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pcryo_1594
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Pcryo_1594
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pcryo_1594
Enzymes [BR:pcr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Pcryo_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: ABE75371
UniProt: Q1QAD2
Position
complement(1952267..1952980)
Genome map
AA seq 237 aa AA seqDB search
MSQSKVYNSAEAALSGVVRNGQTLAIGGFGLCGIPEALIEALRDSGVEDLTCISNNAGVD
DFGLGLLLQTRQIKKMISSYVGENKEFERQYLAGELEVELTPQGTLAEKLRSGGAGIPAF
YTATGVGTLVAEGKETREFDGRTYVLEHSLRADVSLIKAQKADKAGNLIFNKTARNFNPD
CAMAGKITIVEVEEIVETGTLNPDEIHLPGIFVQRIVLNSSPEKRIEKTTTKVVEGA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaaaggtgtataacagcgcagaagcggcgttgagtggtgttgtgcgtaac
ggacaaacgctggcgatcggtggttttggtctatgcggtattcctgaagcgttaatcgaa
gcattgcgggatagtggtgttgaagatttgacgtgcatcagtaataacgctggtgtcgat
gactttggcttgggattgttattacagacgcgccaaattaaaaaaatgatctcatcttat
gtgggtgaaaataaagagtttgagcgccagtacttggcaggcgagttggaagttgagctg
accccgcaaggcaccttagcagaaaaactacgttcaggtggtgcaggtattccggcattt
tataccgcaaccggcgttggtaccttagttgctgaaggcaaagaaacccgcgaatttgac
ggtcgtacttatgtgcttgagcattcattacgcgctgatgtgtctctaatcaaagcgcag
aaagcggataaagcaggtaacttaatctttaataaaacggcgcgtaattttaatccagac
tgtgcgatggcgggcaagattactattgttgaagttgaagagatcgtagaaacaggcacc
ttaaatcctgatgagattcatctgccgggtatttttgtgcagcgtatcgtattgaatagc
agccctgaaaagcgtatcgaaaagacaacaactaaagtggtcgaaggcgcttag

DBGET integrated database retrieval system