KEGG   Psychrobacter cryohalolentis: Pcryo_1596Help
Entry
Pcryo_1596        CDS       T00350                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00450  Selenocompound metabolism
pcr00970  Aminoacyl-tRNA biosynthesis
pcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pcryo_1596
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pcryo_1596
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcr01007]
    Pcryo_1596
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcr03016]
    Pcryo_1596
Enzymes [BR:pcr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Pcryo_1596
Amino acid related enzymes [BR:pcr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Pcryo_1596
Transfer RNA biogenesis [BR:pcr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Pcryo_1596
 Prokaryotic type
   Other AARSs
    Pcryo_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 T4_baseplate DUF4413
Motif
Other DBs
NCBI-ProteinID: ABE75373
UniProt: Q1QAD0
Position
1955163..1957265
Genome map
AA seq 700 aa AA seqDB search
MKVREILVTSALPYANGDIHLGHLVEYIQTDIWVRSMKAQGHKVTYVCADDAHGTAIMLK
AEDNGVTPEQQIANVQAAHEADFAKFLINFDNYHSTHSEENREFSELIYRRLRDAGHIST
RDVEQLFDPEKQLFLADRFVKGTCPECAATDQYGDNCEVCGTTYDATELKNPYSTLSNAT
PILKTSKHYFFDLPEFEQFLKDWTRSDNRLQTSVANKLQEWFDAGLTSWDISRDAPYFGF
QIPDTPSDEPDKYFYVWLDAPVGYMASFQNLCDKRAGTEEALDFDHYWAQENEHKTEVYH
FIGKDIVYFHALFWPAMLAGSELRTPTGVFAHGFLMVNGEKMSKSRGTFIKADTYAEHLH
PEYLRYYFASKLSDKVEDINLDLEDFMQKVNSDLVGKVVNIASRSAGFLVKKYDGMLTDV
CAEPSLLEDITKTGDEIAAAYENREFSRAMRLIMQCADKANEYIDDKKPWALAKVEGAEQ
EVQDVCSVAINIFRQLMVYLAPVLPELTANAKEFLNIDDLSFASRNEWLLGHQINKFKPL
MQRIEEKDIAAMVEDSKASLTQVGAPTASQDDKAAAKNTSPAAMPSSTEQADYIGIEDFA
KVEMKVAHVIACNHVEGADKLLQFTLDVGEAQPRNVFSGIRKFYEPEQLQGKKVICVTNL
APRKMKFGISEGMVLSSGDPKTGLVVITLPDEAVIGDSLA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcgtgagattttagtaaccagtgccctgccctacgccaatggagacattcac
ttggggcatcttgtagagtatatccaaactgatatttgggtacggtcgatgaaggcgcaa
ggtcataaggtgacttatgtctgtgcggatgatgctcatggtactgccatcatgctcaaa
gccgaagacaatggcgtaacaccagaacagcaaattgccaatgtgcaagctgctcatgaa
gccgattttgctaagtttttgattaattttgacaattatcattcaacgcattcagaagaa
aatcgggaattttctgagctaatttatcgccgccttagagatgcaggtcatatctctact
cgtgatgtggagcagctatttgaccctgaaaaacagctgtttttagccgatcgttttgtt
aaaggtacctgccctgagtgcgccgctaccgaccaatatggtgataattgtgaagtttgt
ggtacgacttatgatgcgacagaacttaaaaatccgtactctacgttatcaaatgcgacg
cctattctaaagacttcaaagcattatttctttgacttaccagagtttgagcaattttta
aaggattggacgcgcagtgataatcgcttgcaaacctcagttgctaataagctgcaagag
tggttcgatgccggcttgaccagttgggatatctcgcgtgatgcgccctactttggcttt
caaattccagacacgccaagcgatgagccagacaaatacttctacgtatggctagatgcg
cctgttggctatatggcaagctttcagaacttgtgtgataaacgtgcaggtacagaagag
gctctagactttgaccattattgggcgcaagaaaacgagcataaaaccgaggtttatcac
ttcatcggtaaagacatcgtttatttccatgcgctattttggcctgccatgcttgctggt
agtgaactccgtacaccaactggcgtctttgctcatggcttcttgatggtcaacggcgaa
aaaatgagtaagtcgcgcggcacctttattaaagccgacacttatgctgagcatttgcat
cctgagtacttgcgttattattttgcgagtaagttatctgacaaagtcgaggacattaac
cttgatttagaagactttatgcaaaaggttaactctgatctcgttggtaaagtagtcaat
atcgccagtcgcagcgctggatttttggtcaaaaagtatgatggtatgctgacagacgtc
tgtgctgagccaagcctattagaagacatcaccaagacgggcgatgaaattgctgcggct
tatgaaaaccgtgaattttctcgtgccatgcgcctgattatgcagtgtgctgataaagcc
aatgaatacatcgatgacaaaaaaccgtgggcgcttgccaaggttgaaggcgcagagcaa
gaagttcaagacgtctgctcagtagcaatcaatatcttccgtcaattaatggtatatctt
gcgcctgtattacctgagctgactgccaatgctaaagaatttttgaacattgatgattta
agttttgccagccgtaatgagtggttgcttggtcatcaaattaataagtttaaaccactg
atgcagcgtattgaagaaaaagatattgcagcgatggttgaagattctaaagcctcattg
acacaagtaggtgcgcctaccgctagccaagacgataaagcagcagcaaaaaatacctcg
cctgcagcaatgccaagcagtaccgaacaagcagactatatcggtatcgaggactttgcc
aaagtcgagatgaaagtcgctcatgttatcgcttgcaaccatgtcgaaggcgcggacaaa
ctgcttcagttcacactagatgttggtgaagcacaacctcgcaacgtctttagtggtatt
cgcaaattctatgagcctgagcaattacaaggtaaaaaggttatttgcgtgaccaatttg
gcaccgcgtaagatgaaatttggcatatcagaaggcatggtattgtcgtcaggcgacccg
aaaacaggtctggtggtaattaccttacctgatgaagccgttatcggtgattcactggct
taa

DBGET integrated database retrieval system