KEGG   Psychrobacter cryohalolentis: Pcryo_1707Help
Entry
Pcryo_1707        CDS       T00350                                 

Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00540  Lipopolysaccharide biosynthesis
pcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Pcryo_1707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pcr01005]
    Pcryo_1707
Enzymes [BR:pcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     Pcryo_1707
Lipopolysaccharide biosynthesis proteins [BR:pcr01005]
 Lipid A
  Pcryo_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep LpxD Hexapep_2 Fucokinase DUF4954 HU-CCDC81_bac_2
Motif
Other DBs
NCBI-ProteinID: ABE75484
UniProt: Q1QA19
Position
complement(2112081..2113097)
Genome map
AA seq 338 aa AA seqDB search
MITIEQLISQIEQRQPVLNKAELSAEQRRLSLEGIGNLTMANRQQLSFLANPHYLSSLAN
TDAGAVLITEEHHEEVPNDTVALIVAVPYLAYASVSQIFARQHSFSGIHPTAFIADSAVI
GNKVTIGAFCVIGEQVQIGDRSVLEAHVVIEDNTTIGTDGVIKSQVVIGHDCIIGSHVRL
HAGVTIGSEGFGFAPTANPSVTGWERIAQLGRVLIGDHVRIGSQTCIDRGAIDDTVIGNH
VIIDNLVQVAHNVRIGDGTAIAAHTGIAGSTTIGKRCIIGGAVGITGHIDITDDVTLSGM
TMVTKSITTAGSYSSGTAAMPTANWRRAAVRFRQLGRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgataacgattgagcaactcatctcccagattgagcagcgtcagcctgttcttaacaag
gctgagcttagcgctgagcagcgccgtctatccttagagggtattggtaatttaacgatg
gctaatcggcagcagttgagctttttggccaatcctcactatctttctagtctagctaat
actgatgctggggcagtactcatcactgaagagcatcatgaagaagtgccaaatgatacg
gtagctttaattgttgctgtcccttatttggcttatgctagtgtgagtcaaatttttgct
cgccaacattcatttagcggtattcatccgacagccttcatcgccgacagtgccgttatt
ggcaataaagtgactatcggcgctttttgtgtcatcggtgagcaagtgcagattggtgat
cgcagcgtgcttgaggctcatgtagtcatcgaggataatactaccattggtacagatggt
gttatcaaatcacaagtggtgataggacatgactgtattattggtagtcatgttaggttg
cacgctggggtgacgataggctcggaaggctttggctttgcacccactgccaatcctagt
gtcacaggttgggagcgtattgcacagttagggcgtgtgctgataggtgatcatgtacgc
attggcagtcaaacctgtatagatcgcggtgccatcgatgatacggtgattggaaatcat
gttattattgataacctcgtacaagtagcacacaacgtccgtattggtgatggtacggct
atcgctgctcatacaggtattgcaggtagtactacaattggcaaacgctgcattattggc
ggggcggtcggtattaccggacatattgatatcacagatgatgttaccttatcgggtatg
actatggtcactaagtcaatcaccactgccggatcttactcttctggcacggctgctatg
ccaactgctaactggcgccgtgcggctgtccgttttcgccagcttggtcgtgattag

DBGET integrated database retrieval system