KEGG   Psychrobacter cryohalolentis: Pcryo_1946Help
Entry
Pcryo_1946        CDS       T00350                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pcryo_1946
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    Pcryo_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABE75723
UniProt: Q1Q9D0
Position
complement(2400413..2400868)
Genome map
AA seq 151 aa AA seqDB search
MSIVNKYQLVGMLVAALLLSACEKTPPDYRATVTLPLYIEGDADNGALIYQDACGQCHQL
NPGLNKKGPQLMNIYGAPAAELADYTYSEGLKASGWVWDAQTLDTYIADAEKAMPDSKML
SDPMPDSKERADVIAYLSTLRAAAPSVENDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagtcaataaatatcaactggtcggtatgcttgtcgccgctttgctgctaagt
gcttgtgagaaaacgccgcctgattaccgtgctactgttacgctaccgctttatattgaa
ggcgatgccgataatggtgcactcatatatcaagatgcttgtggtcagtgtcatcagtta
aaccccggtctcaataaaaaaggcccgcagctgatgaatatttatggcgcgccggcagcg
gaacttgcagattatacttatagtgaaggacttaaagcctcgggttgggtatgggatgct
caaacgcttgatacttatattgcggatgctgaaaaagccatgccagattctaaaatgctg
tcagacccgatgccagattctaaagagcgcgctgatgtgatcgcttacttgtctaccctt
cgcgcagctgccccaagtgttgaaaatgataaataa

DBGET integrated database retrieval system