KEGG   Psychrobacter cryohalolentis: Pcryo_2019Help
Entry
Pcryo_2019        CDS       T00350                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00790  Folate biosynthesis
pcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcryo_2019
Enzymes [BR:pcr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pcryo_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE75796
UniProt: Q1Q957
Position
complement(2481980..2482903)
Genome map
AA seq 307 aa AA seqDB search
MSLFQPLAAYAVTSRDKVLDLSQPHIMGILNVTPDSFSDGGQFNAVDKAVARCKEMIDAG
ATIIDIGGESTRPNAEVVATSDELQRVVPVVTAIRQQLGNDIWLSIDTSSPEVMQAAFEV
GADIWNDVRALKREGAAVMAAKLNIPVMLMHMRGEPTTMNNLAQYDDVVREVMTELEVRI
DEVTSIGVMRENIIIDPGFGFAKNYQHHCALLSELKRLQTLRLPMMFGISRKRFLAEVLT
KTGLEALATTQPLERDNVGTAAGLFALQQGASIIRTHNVAMMQQAIALWSQLSAYDKYQS
LSLDGCN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcactattccaacctttagctgcttatgctgtgaccagccgtgataaggtcttagat
ttatcacagcctcatatcatgggcatcttaaatgtcacgccagattcgttctcagatggt
ggacagtttaatgcagttgataaggcagtagcacgatgtaaagagatgatcgatgcaggt
gctaccattatcgatattggcggcgagtctacccgtccaaatgctgaagtggtagcgact
tctgatgagctacagcgtgtggtaccagtcgtgacagcgattaggcagcagctaggcaat
gacatatggctatccattgataccagtagtcctgaggttatgcaagcagcgtttgaagta
ggtgcggatatttggaatgatgtacgggcactcaagcgtgagggcgctgcggtgatggca
gctaagcttaatattcctgttatgctcatgcatatgcgcggtgagccaactacgatgaat
aatctggcacagtatgatgatgtggttagggaagtcatgacagagctagaggtgcgtatt
gatgaagtgacaagcattggtgtcatgcgcgaaaatattattattgaccccggttttggt
tttgctaaaaactatcagcatcactgtgcattattgagtgagcttaagcgcctacaaaca
ctcagactgccaatgatgtttggtatttcacgcaagcgatttttagcagaagtgctgaca
aaaacaggtctagaagcgcttgctaccacccaaccgcttgagcgtgataacgtgggtact
gctgcaggtctttttgcattgcagcagggggcaagtatcattcgtactcataatgttgct
atgatgcagcaagccatagcgttatggagccagctatctgcatatgataaataccaatcg
ctatcactagatggctgcaattaa

DBGET integrated database retrieval system