KEGG   Psychrobacter cryohalolentis: Pcryo_2217
Entry
Pcryo_2217        CDS       T00350                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
pcr  Psychrobacter cryohalolentis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcr03016]
    Pcryo_2217
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     Pcryo_2217
Transfer RNA biogenesis [BR:pcr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    Pcryo_2217
 Prokaryotic type
    Pcryo_2217
SSDB
Motif
Pfam: Tyr_Deacylase
Other DBs
NCBI-ProteinID: ABE75994
UniProt: Q1Q8K9
Position
complement(2721880..2722335)
AA seq 151 aa
MRSLIQRVKYASVSVDGQEVGAIEQGVLAYIGLGHDDNLQSAQRMIDKILTYRIFDNDDD
PAKYGKVDKNVQQVGGGLLLVSQFTLMAKTDKGRRPEFGSAMAPDMAQALFAQLVDYAKT
QYLTVATGQFGADMQVLSVNDGPLNFLLEVH
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagatctcttattcagcgagtcaaatatgccagtgtcagcgttgatgggcaggaggtc
ggtgctattgagcaaggtgtgctggcatatatcggcttgggacacgatgataacctacaa
agtgcgcagcggatgattgataaaatcctcacctatcgtatttttgacaatgatgatgat
ccagccaaatacggcaaagtcgataaaaatgtccagcaagtcggtggtgggctattattg
gtctcacaatttactctgatggcaaagacggataaaggtcgccgccctgaatttggtagc
gcaatggcacctgatatggctcaagctttatttgcacaattggttgattatgcaaagacg
cagtatttaacggttgcaacgggtcagtttggcgctgatatgcaagtattgagtgtcaat
gatggaccattaaactttttattagaagtgcattaa

DBGET integrated database retrieval system