KEGG   Psychrobacter cryohalolentis: Pcryo_2377Help
Entry
Pcryo_2377        CDS       T00350                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00300  Lysine biosynthesis
pcr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pcryo_2377
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pcryo_2377
Enzymes [BR:pcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Pcryo_2377
Peptidoglycan biosynthesis and degradation proteins [BR:pcr01011]
 Precursor biosynthesis
  Amino acid ligase
   Pcryo_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ABE76154
UniProt: Q1Q849
Position
complement(2922235..2923947)
Genome map
AA seq 570 aa AA seqDB search
MTLSTSSPSSITVTLQQLLAASSSDDRHSLQQVFTANMTAAVSESSHQITAVQLDAVINI
PFQQFCLDSRQLASNDVFVLLKSHTPNCQKSRDHLYQAANNAAFILSEIDPRALLNTTSV
SNHADITLPNDSTAKAQQQLVALPCPVLHVPNIRDFLGTLIQARLQYQQPVTLPTVIAVT
GTNGKTTISQLVAQLTQLTGMSSAVMGTAGNGRFGALVQASHTTGDVLAVQQFLYQMGKE
GAELLALEASSHGLDQQRLQGMPVSVAIYTNLSRDHLDYHADMAEYAAAKAKLFDKAHFP
DLTHAIINIDDEHAQIMLDTAHASNLTVWTYSLDSLKTATFVAANITPSLRGVEISLRTD
FDDGTMNHLDIVSPLLGRFNVANLLAAMAAAVALGISLEHIAAVVPQLQGAVGRMQRVPS
NDGCFIVDYAHTPDALSQVLASLKTHCKGQLWAVFGCGGDRDAGKRPLMAQAGLAGADKV
VLTADNPRTEDPNAILQDMQVGMSTEQYQRTHIEPARQAAIEYAVNQAAADDIVVIAGKG
HETYQEINHVRYDFDDSVILQNALKQAGRV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtctacctcgtcgccaagcagtatcacagttaccttgcaacagctgcttgca
gctagtagcagcgacgatagacatagtctacagcaggtatttacagcgaatatgaccgca
gctgttagcgagtcatcgcatcaaataaccgctgttcaactggatgcggtgatcaatatt
ccattccagcagttctgtttagacagccgtcaactagccagcaacgacgtgttcgtcttg
ttaaaaagccatacgccaaattgccaaaaaagccgtgaccacctttatcaagccgctaac
aatgcggcttttatcctatcagaaatagatcctagggctttacttaacacgactagtgta
tcaaatcatgccgatatcaccttaccaaatgatagtactgctaaagcgcagcagcaatta
gtagcactgccttgccccgttttacatgtgcccaacattcgtgattttttagggacactc
attcaagcacgtttgcagtatcagcagcccgtgacattaccaactgtcatagccgtgacg
ggcaccaatggcaaaaccaccattagccaattggtggcacaattgacgcagctgacaggt
atgagcagcgcagtcatgggcacggcaggtaatggtaggtttggtgctttggtgcaagcc
agccataccacgggagatgttttagcggtccagcagtttttgtatcaaatgggcaaagaa
ggtgctgaactactagcattggaagccagctcacatggtttagatcagcagcgtctgcaa
ggtatgccagtgtcggtggcgatttataccaacctgagtcgcgatcatttagattatcat
gctgatatggcagagtacgcggcagctaaagccaagttgtttgataaagcccattttccg
gatttgacccatgccattatcaatatcgatgacgagcatgcccagattatgcttgacacc
gcacacgctagcaatttgaccgtttggacatacagcttagattcactaaaaacagctacc
ttcgtcgccgctaacatcacgccaagtttacgaggtgtagagatcagcctgcgtacagat
ttcgacgatgggacaatgaatcatttagatatcgttagcccattattgggacgttttaac
gtggcgaatttacttgctgctatggcagctgctgtagctttaggcattagccttgagcat
attgccgcagtggtgccgcagttacaaggtgcggttgggcgtatgcagcgtgtaccatcg
aatgatggttgtttcatcgtcgattatgctcacacccctgatgccttaagtcaggtgctt
gccagtctcaaaactcattgtaaaggccagctatgggcagtgtttggctgcggtggcgac
cgtgatgcgggcaaacgtcctttgatggcgcaagcaggattggcaggcgcggataaagtc
gtgttaacggcagacaatccacgtactgaagaccccaacgcgattttgcaagatatgcag
gtagggatgagcactgagcaatatcagcgtacccatattgagcctgcgcgccaagcagcg
attgagtatgcggtcaatcaagcagcggctgatgatatcgtcgttattgctggcaagggt
catgagacctatcaagagattaatcatgttcgttatgattttgacgacagtgttattttg
caaaatgccttaaaacaagcagggcgcgtatag

DBGET integrated database retrieval system