KEGG   Psychrobacter cryohalolentis: Pcryo_2472Help
Entry
Pcryo_2472        CDS       T00350                                 

Definition
(GenBank) tRNA modification GTPase trmE
  KO
K03650  tRNA modification GTPase [EC:3.6.-.-]
Organism
pcr  Psychrobacter cryohalolentis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcr03016]
    Pcryo_2472
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     Pcryo_2472
Transfer RNA biogenesis [BR:pcr03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Pcryo_2472
 Prokaryotic type
   Methyltransferases
    Pcryo_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MnmE_helical TrmE_N MMR_HSR1 FeoB_N RsgA_GTPase Ras AIG1 Arf Gtr1_RagA Dynamin_N Roc GTP_EFTU MCM MMR_HSR1_Xtn ABC_tran AAA_28 AAA_16
Motif
Other DBs
NCBI-ProteinID: ABE76249
UniProt: Q1Q7V4
Position
complement(3055907..3057370)
Genome map
AA seq 487 aa AA seqDB search
MRVLVDSQELALAAPESSKNLGLSSLPTIAAIATPLGRGGVGVIRLSGTHAYSIACTLTG
KSAFKPRMASFCRFYQADGTVIDEGLVLYFKGPHSFTGEDVIELQGHGGMILQNQLLARV
FELGAKQASAGEFSYRAFDNDKLDLVQAEAIADAIDATSAAAASSAIRSLSGEFSQKINQ
LLEQLIHLRLHVEAAIDFPDEEDVDFLSDGVIQGKLEQTQEKIQQVLATAKQGQLLRDGI
HVVLAGRPNAGKSSLLNRLAGQERAIVTDVAGTTRDTLQETVVLNGLTLHLTDTAGLRET
EDTVERIGIERARTAIAQADMLLMVYDVTRDLEEESTPLQLAEQLFGELPEAKRLLIIAN
KSDLLNNNSSKEITSISQQEIHNRGYEQVNVSCETGAGIDDLVETLCAKVGFHPPENSLI
ARTRHLDALRRTAEYLAEAHEQLTVFKAGELVAESLRQAQHSLGEITGEFSADDLLGKIF
GSFCIGK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgagagtgcttgtggattcccaagagttggcgttagccgcccctgagtcatcaaaaaat
ctcggtttgtcgagtctgcctaccattgccgctattgctacaccgcttggacggggtggg
gtcggggttattcgtctgtctggtacacatgcgtatagcattgcttgtacgctgacaggt
aagtcagcatttaaaccgcgcatggcgagcttctgccgattttatcaagcagatggtacg
gttatcgatgaagggttggtgctgtattttaagggtccgcactcgtttactggcgaagat
gtgattgaactgcaaggtcatggtggcatgattttgcaaaatcagttgttggcacgtgtg
tttgagttaggggcgaaacaagcaagtgctggagaattctcttatcgtgcctttgataat
gataagttggatttggtacaggcagaagccattgcagatgcgattgatgctaccagcgct
gctgctgccagcagtgctattcgctccttaagcggtgaattctcgcaaaagattaatcag
ctacttgagcagttaattcatctgcgtctgcatgttgaagcagctattgatttccctgat
gaagaagacgttgattttttatcagatggggtcatacaaggtaagcttgaacagacacaa
gaaaaaatccagcaggtcttggcgactgctaagcaaggacaattattacgtgatggtatt
catgtggtgttggcaggtagacctaatgctggtaaatcaagcctgctcaatcgcttggca
gggcaagagcgtgctatcgtcactgatgtggcgggtacaacgcgtgatacactacaagaa
accgttgtcctcaatggtttgacgctacacttgactgatacggcaggcctgcgcgagaca
gaagacacggtcgagcgtatcggcattgagcgcgcgcggacagcgattgctcaggcagat
atgctgttaatggtttatgatgtaacccgtgatcttgaagaagaaagtaccccattacag
ctcgctgagcagctatttggcgagctaccagaagccaagcgcttgttaattatcgctaat
aaaagtgatttattaaacaataatagcagcaaagaaataacctctatttcgcaacaagag
attcataatcgcggttacgagcaagttaatgtttcatgtgaaacaggcgcaggtattgat
gatttagtcgaaactctgtgtgctaaagtagggtttcatccacccgaaaatagcttgata
gctcgtacgcgtcatctagatgcgttaagaagaacggccgaatatttagcagaagctcat
gagcagctaaccgtctttaaagcgggtgaattagttgctgaaagtttgcgtcaagctcag
catagtctgggcgagattaccggggagtttagtgcagatgatttgttgggcaagattttt
ggcagtttttgcattggtaaataa

DBGET integrated database retrieval system