KEGG   Porphyromonas crevioricanis: NCTC12858_01600Help
Entry
NCTC12858_01600   CDS       T05510                                 

Gene name
selD
Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pcre  Porphyromonas crevioricanis
Pathway
pcre00450  Selenocompound metabolism
pcre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NCTC12858_01600 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcre03016]
    NCTC12858_01600 (selD)
Enzymes [BR:pcre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     NCTC12858_01600 (selD)
Transfer RNA biogenesis [BR:pcre03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NCTC12858_01600 (selD)
 Prokaryotic Type
    NCTC12858_01600 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: SQH73734
UniProt: A0A2X4PIG1
Position
1:1829769..1830791
Genome map
AA seq 340 aa AA seqDB search
MEDRPYGGCSAKIDPLALGKLLSGIAVTSDPNVMVGLSTCDDAGVYRLNDETALIVTTDF
FPPVVDDPFTFGRIAATNALSDVYAMGGKPLLSLNLTHYPSKRLPLEGLREILRGGQEAV
EESGAITMGGHTIEDETTQYGLAVVGTVHPKKLITNAGACPGQKLILTKPLGIGVQLAGK
RLDLTPKDSYQLTVETMCRLNRYAAEIMTEAGVRTATDVTGFGLIGHAWEMARASAVGVE
IETSSLPCIDGSLELLDDGCIPGAAFRNIRYVGDALQVRCSTNQLYLSADPQTSGGLLMA
VDSEHVDSTLQQLHAAGETSATVIGSIVPTSAHGAGVCLL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaggccctatgggggatgctcggccaaaatagatccacttgctttggggaaa
ctgcttagcggtatagctgtaacttctgatcctaatgtaatggtgggactctcaacctgt
gatgatgccggagtctacagattgaatgacgaaacagccttgatcgtaacgactgatttt
ttccctcctgtagtggatgacccatttacttttggtcgtattgctgccaccaatgcccta
agtgatgtatatgcaatgggagggaaacccctcctatctctcaacctgacacattatccc
tccaaacgcctccctctggaaggattgagagagatattgcgtggcgggcaggaggctgta
gaagaatcgggggctattacgatgggtggccatacgatagaggacgagacgactcagtac
ggcttggctgtggttggcactgtgcatccgaagaaactaatcaccaatgcaggagcctgt
cccggacaaaaactaatactaaccaaacctcttgggataggtgtacagttggctggcaaa
cgacttgacttaaccccaaaagactcctatcaactaactgtagaaacgatgtgccgactc
aatagatatgcagctgaaataatgacagaagcaggggtacggacagcgacggatgtgacc
ggctttggattgataggtcacgcatgggaaatggcccgagcctctgccgtaggtgtagag
atagagacctcatcactcccctgcattgacggatctctggaactgctcgatgatggttgt
atccctggtgcagcattcagaaatatccgctatgtgggagatgcactacaagtccgttgt
tcgaccaaccagctctacttgtcggcagatccacaaacttccggaggcctgctcatggcc
gttgattcggagcatgtcgatagtacattacagcaattgcacgcagccggagagacgagt
gcaaccgtcataggctccattgtaccgacctctgctcatggtgcaggcgtttgccttctt
tag

DBGET integrated database retrieval system