KEGG   Penicillium rubens: Pc12g06870Help
Entry
Pc12g06870        CDS       T01091                                 

Definition
(RefSeq) Pc12g06870
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pcs  Penicillium rubens
Pathway
pcs00020  Citrate cycle (TCA cycle)
pcs00640  Propanoate metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
Module
pcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pc12g06870
   00640 Propanoate metabolism
    Pc12g06870
Enzymes [BR:pcs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Pc12g06870
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pc12g06870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 8313073
NCBI-ProteinID: XP_002557525
UniProt: B6H0P7
AA seq 329 aa AA seqDB search
MQAFRRNTLSALRNVGATQRRTQATSAYSETLNNLKINKDTRVLFQGFTGKQGTFHAEQA
IAYGTNVVGGTNPKKAGTTHLDRPVFANVSDAVKETGATASAIFVPPPLAAAGIEEAIAA
EMGLVVCITEGIPQHDMVRITDILKTQNKTRLIGPNCPGIIAPGQCKIGIMPGFIHKRGR
VGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFLEDPETDGIIMI
GEIGGSAEEDAAEFFKANNIHNKPAVSFIAGISAPPGRRMGHAGAIVSGGKGGADSKISA
LTDAGVIVERSPASLGKTLLAEFVKRDLV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccttccgccgtaacaccctctcggcccttcgcaatgtcggtgccacccagcgt
cggactcaggccacctctgcctacagcgagaccttgaacaacctcaagatcaacaaggac
acccgcgttctgttccagggtttcactggaaagcagggaaccttccacgctgagcaggcc
atcgcctacggcacaaatgtcgtcggtggtaccaaccccaagaaggccggcaccacgcac
cttgaccgtcccgttttcgccaacgttagcgatgccgtgaaggagaccggtgccacagct
tccgccatcttcgttcctccccctcttgccgctgctggtatcgaggaggccatcgccgct
gagatgggcctcgttgtttgcattactgagggtatccctcagcacgacatggtccgcatc
accgacattctcaagacccagaacaagacccgcctgatcggtcctaactgccccggtatc
atcgctcccggtcaatgcaagatcggtatcatgcctggcttcatccacaagcgcggccgt
gtcggtatcgtctcccgttccggtaccctgacctacgaggccgtcaaccagaccacccaa
gctggccttggtcagtccctcgtcgtcggtatcggtggtgaccccttctccggcaccaac
ttcatcgactgcctcaaggtcttcctcgaggaccccgagaccgacggtatcatcatgatc
ggtgagattggtggttccgccgaggaggatgccgccgagttcttcaaggccaacaacatc
cacaacaagcccgccgtctctttcattgccggtatctctgctccccccggccgccgcatg
ggtcacgccggtgccatcgttagcggtggcaagggtggtgctgactccaagatctccgct
ctcaccgatgctggtgtcatcgtcgagcgcagccctgcctccctcggcaagacccttctt
gctgagttcgtcaagcgcgaccttgtttaa

DBGET integrated database retrieval system