KEGG   Penicillium rubens: Pc12g15240Help
Entry
Pc12g15240        CDS       T01091                                 

Definition
(RefSeq) Pc12g15240
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pcs  Penicillium rubens
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pc12g15240
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     Pc12g15240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 TALPID3
Motif
Other DBs
NCBI-GeneID: 8308179
NCBI-ProteinID: XP_002558326
UniProt: B6GXH0
AA seq 578 aa AA seqDB search
MAGNTLAIRKMAPSIMQLSSMTRRSMSTSQLALRAKPMRSTKVSQSVSRIARRGYADAAP
SPAPKPKKRFRALRWAWRLTWLSAIGLTGTVAYSIFELRQPPEQITPDPSKKTLVILGTG
WGSVSLLKKIDTENYNVVVVSPRNYFLFTPLLPSCTTGLIEHRSIMEPIRNILRHKKASV
QFYEAEATKIDYEKRIVYISDDSEIKGDISHTEVPFDMLVIGVGAENATFGIPGVRENSC
FLKEVGDAQNIRKRIMDCIETACFKDQTEDEVKRLLHMVVVGGGPTGVEFAGELQDFFND
DLKKWIPEIKDNFHVTLVEALPNVLPMFSKQLIDYTESTFKEEEISIRTKTMVKNVTDKY
IQAEVTKPDGSKELETIPYGLLVWATGNAIRPVVRDLMSQIPAQAESRRGLAVNEYLVVN
GTDNVWAVGDCAIANYAPTAQVASQEGAFLGRLFNTMAKAEALEKELEALSERQSQAKAA
EERNQIFDEIRERQKQLRRNKQIGPFQYSHQGSLAYIGKERAVADISWLSGNIASGGTMT
YLFWRSAYLSMCFSTRNRVLVCVDWVKARLFGRDVSRE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaatacgctagcaattcgcaagatggctccgtccatcatgcagctgtcgtcg
atgacgcgcagatccatgtcgacatcgcagctggcccttcgcgcaaagccgatgcggtcg
accaaggtttcccagtctgtatcgcgtattgctcgtcgtggctacgctgatgctgcccct
tcgcccgccccgaagcctaagaagcgtttcagagctctgcgttgggcctggcggctgacc
tggctctctgccatcggtcttaccggtactgtcgcatacagcatcttcgagctccgtcaa
cccccggagcagattactcctgacccatcaaagaagactctggtcattctcggaactggc
tggggctccgtctccctcctgaagaagattgacaccgagaactacaacgttgtcgtcgtc
tccccccgtaactacttccttttcactcccttgctgccctcatgtaccaccggtttgatc
gagcaccgctcgatcatggagcctatccgaaacatcctgcgccacaagaaggccagtgtt
cagttctacgaggccgaagccaccaagattgactacgagaagcggattgtgtatatcagt
gatgattccgaaattaagggtgatatctcgcacaccgaggttcccttcgacatgcttgtg
atcggtgttggtgccgagaacgcgacttttggtattcccggtgttcgtgagaactcctgc
ttcctgaaggaagtcggtgacgcccagaacattcgtaagcgtattatggactgtatcgag
accgcctgtttcaaggaccagaccgaggacgaggtcaagcgtctgctgcacatggttgtg
gtgggcggtggccccactggtgttgaattcgccggtgaactgcaggacttcttcaacgat
gacttgaagaagtggattcccgaaatcaaggacaacttccacgtcactctcgtcgaggct
ctgcccaacgttcttcccatgttctccaagcaactgattgactacactgaatcgaccttc
aaggaggaggagatctctatccgcaccaagaccatggtcaagaatgttaccgacaagtac
atccaggctgaggtgaccaagcccgacggatccaaggagcttgagactatcccctacggt
cttctcgtctgggccaccggtaacgccatccgccccgttgtccgcgacctgatgtcccag
atccccgctcaggccgagtcccgccgcggtctcgctgtcaacgaatacctcgtcgtgaat
ggtaccgataacgtctgggccgtcggcgactgcgctattgccaactacgcccccaccgcc
caggttgctagccaggagggtgccttcttgggccgcctcttcaacaccatggccaaggcc
gaggctctcgagaaggagttggaggctctctctgagcgccagtcccaggccaaggccgcg
gaggagcgcaaccagatcttcgacgagatccgtgagcgccagaagcagctccgccgtaac
aagcagatcggtcccttccagtactcgcaccagggttccttggcctacatcggtaaggag
cgcgccgtggccgatatcagctggctgagcggcaacatcgccagcggtggtactatgacc
tacctgttctggcgcagtgcctacctgagcatgtgcttcagcactcgcaaccgtgtcctt
gtctgcgtcgactgggtcaaggctcgtctcttcggccgtgatgtctcccgggagtaa

DBGET integrated database retrieval system