KEGG   Penicillium rubens: Pc13g05350Help
Entry
Pc13g05350        CDS       T01091                                 

Definition
(RefSeq) Pc13g05350
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pcs  Penicillium rubens
Pathway
pcs00330  Arginine and proline metabolism
pcs00332  Carbapenem biosynthesis
pcs01100  Metabolic pathways
pcs01130  Biosynthesis of antibiotics
pcs01230  Biosynthesis of amino acids
Module
pcs_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pc13g05350
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Pc13g05350
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Pc13g05350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 8317327
NCBI-ProteinID: XP_002558969
UniProt: B6H2J6
AA seq 429 aa AA seqDB search
MATSSGLTIVIKLGTSSIVDEKTHEPILSILTLIVETVTKLHRDGHRVVLVSSGAVGVGL
RRMNVDERPTYLPRIQALAAVGQCRLMSLWDNLFGHLRVPVAQILLTRNDIADRTQYVNA
QNTFGQLFDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMIKADYLFLMTDVDCLYSA
NPRTNPDAKPIEVVTDISSLEADVSSAGSSLGTGGMSTKIVAARLGTSAGVTTVITKSSK
PGNVHDIVKYLQYLEARSNGVAADDQHETHTAPLHTRFIRSNTPIQSRTFWLLHGLYPHG
TLYIDRGAYHALLNNANLLPVGVVGVEGHFGQQESVRLVVVDRPSPDALNGDFIHHSEEP
KEVGRALVNYGSIEITHIKGHRSTQIETLLGYADSNYVAMRENISFHPEHRKHKVTPSLT
PALEEWKSP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcatcgggtctcacgattgtgatcaaattaggaacgagttcgattgtcgac
gagaaaacccacgagccaattctttcgatcttgacattgattgtggaaacggtgaccaag
ctacacagagatggtcaccgggtcgtccttgtatcatctggtgccgtgggcgttggacta
cgaaggatgaatgtggacgaaagaccaacatatctgccacgcatacaggctctcgctgca
gttggccaatgtcgactgatgagtctttgggataatctattcgggcatctccgtgtccct
gtggcccagattcttttgacgagaaatgatattgctgatagaacccaatatgtcaatgcg
caaaatacatttgggcagttgtttgatatgggagtgatccctattgtcaacgaaaatgat
accctggctgtttctgaaattaaatttggcgacaacgataccctttctgcaattactgcg
gcaatgatcaaggccgactatctgtttttgatgaccgatgtcgactgtctctattcggcg
aaccctcgaaccaacccagacgcaaaacccattgaggtagtgaccgatatctcctctctc
gaggctgatgtctcatcagcaggctcctctcttgggactgggggtatgagcacgaagatt
gtggctgctaggcttggaaccagtgctggtgtcactacggttatcaccaagagctcaaaa
ccgggcaacgtccacgacattgtgaaatacctacaatacctcgaggctcggtccaatggc
gtagcagctgacgaccaacatgagacacacactgccccccttcatacccgattcatccgt
tcaaataccccgattcaatcacggacattctggctacttcatggactgtacccacatggt
acgttatacatcgaccgcggagcttaccacgcactcttgaataatgccaaccttctcccg
gttggagtggtcggggttgaaggccattttggacagcaggaatccgtgcggctagtagtt
gttgatcggccatccccagatgcgttgaatggcgattttatccaccacagtgaggaaccc
aaggaagtcggtcgggctttggtgaactacggaagcattgaaatcacccacatcaagggc
catcgcagcacacagattgagacgctacttggctatgccgatagcaactatgtggcgatg
cgagagaacatctcattccacccagaacaccgcaagcataaggtgacaccgtccttaaca
ccagccttggaggaatggaagtccccttga

DBGET integrated database retrieval system