KEGG   Penicillium rubens: Pc13g07310Help
Entry
Pc13g07310        CDS       T01091                                 

Definition
(RefSeq) Pc13g07310
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pcs  Penicillium rubens
Pathway
pcs00450  Selenocompound metabolism
pcs00970  Aminoacyl-tRNA biosynthesis
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pc13g07310
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pc13g07310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcs01007]
    Pc13g07310
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcs03016]
    Pc13g07310
Enzymes [BR:pcs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Pc13g07310
Amino acid related enzymes [BR:pcs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Pc13g07310
Transfer RNA biogenesis [BR:pcs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Pc13g07310
 Prokaryotic type
   Other AARSs
    Pc13g07310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 8309892
NCBI-ProteinID: XP_002559162
UniProt: B6H3T0
AA seq 570 aa AA seqDB search
MSTARTPLRLLLRASQLLRSRHPWNCTSRNHGWATTPRRGVATTPQRSNKPYYVTTPIFY
VNAAPHVGHLYTMVIADIMKRWQVLLGNTDAQLLTGTDEHGMKIQQAAIQAGMDTQAFCD
MNCRTFEALAKAANIDNDHFIRTTDPAHRDAVQYFWEMLQHRGYIYTSRHEGWYSVSDET
FYPQTQVQNSLDPSTGRKRMVSIETGKEVEWSSETNYHFRLSAFKDRLLDLYKREDPFIS
PTSYTAAVINGVETGLQDLSISRPTERLTWGIPVPGDDTQTIYVWLDALVNYLTKAGYPF
PPGQENTSAWPADLHVVGKDIVRFHCVYWPAFLMALDLPLPRNVLVHGHWTMNHEKMSKS
TGNVVNPFFAIERFGVDGMRFFLAYRGGLADDADFDNSFIIRDYKKLLQGGIGNLALRTI
GCARGNLRSYIMDALSNKLPAATPEDLDHQKMLEQTPPKVAEFMENLNPRAALQETMSII
EKTNKYFHAAEPWKTSNSRAIYNVAESLRIAGILLQPFMPGKSHDLLELLCVNTSDPSKR
AFSATVYGSDPDYGEGVKKGILFPPLLTEE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcaaggacgccactccgcttgttacttagagcgtctcagcttctgaggtcg
aggcatccgtggaactgtacatcccgcaatcatggttgggcaacgactccccgacgcgga
gttgcaactacgccgcaaaggtccaacaagccttactatgtgaccacgccaatcttctac
gtcaatgccgcgcctcatgtcggccatttatacacaatggtgattgccgatatcatgaaa
cggtggcaggtcttgctcgggaatacggatgctcagctattgaccggaaccgatgagcac
ggaatgaagattcaacaagctgcgatccaagcgggcatggatacccaggcattttgcgat
atgaactgccgaactttcgaggccctagcaaaggccgcaaacatcgacaacgatcatttc
atcaggaccacggacccagcacatcgagacgccgtccaatacttttgggaaatgttgcaa
cacaggggctatatctatacctcgaggcacgaaggttggtactcagtcagcgatgagaca
ttctacccacaaacgcaagtgcagaactccctagatccatcaacagggaggaaacgcatg
gtctcaatagaaacgggtaaagaggtagagtggtcctcagaaaccaactaccacttccgt
ctttcagccttcaaggatcgcctacttgacttgtacaaaagagaagatccgttcatcagc
ccaacctcctacacagctgctgtgatcaatggagtcgagacgggactacaggatctctcg
atttctcggcccacggaacgtctgacctggggcatccctgttcccggcgatgacacacag
acaatctacgtgtggctagatgcattggtcaactacttgaccaaagctggatatcctttc
ccacccggacaagaaaacacatctgcatggcctgcagacttgcatgtagttggcaaagat
attgttcgattccattgtgtttattggcccgctttcctcatggcacttgatctccccctg
cctcggaacgtcttagtgcacgggcactggacaatgaaccatgaaaaaatgtccaaatcc
acaggcaatgttgtgaacccgtttttcgccattgaacggttcggagtcgatggcatgcga
tttttcctagcgtatcgaggtggccttgcagatgatgcggactttgacaattcctttatc
atccgagattacaagaaattgcttcagggaggcatcggaaaccttgctctgcgtacaatt
ggatgtgcgcgtggcaatttgcgctcgtacattatggacgccctatccaataagcttcca
gctgctacccctgaagacctggatcatcagaaaatgttggagcagacgcctcccaaggtt
gccgagtttatggagaatctaaacccgcgtgccgcgctgcaagaaactatgagcattatc
gagaagactaacaagtacttccatgcggcggagccgtggaaaacttccaactcacgagcg
atctacaacgtggcggaatcgcttcggatcgctggcattttattgcaaccgttcatgccc
ggcaagtctcatgatcttctagaattgctctgtgtaaacacctcggacccctccaagcgg
gcattctcggccacggtgtacggttcggatccagattacggtgagggcgttaagaaaggt
atacttttccctcctttgctcactgaggagtaa

DBGET integrated database retrieval system