KEGG   Penicillium rubens: Pc13g09710Help
Entry
Pc13g09710        CDS       T01091                                 

Definition
(RefSeq) Pc13g09710
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00220  Arginine biosynthesis
pcs00330  Arginine and proline metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01230  Biosynthesis of amino acids
Module
pcs_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Pc13g09710
   00330 Arginine and proline metabolism
    Pc13g09710
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Pc13g09710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 8303902
NCBI-ProteinID: XP_002559394
UniProt: B6H4I2
AA seq 324 aa AA seqDB search
MTQPSTITSRFLSHPNQLGVVAVGFNGGQCKKGVEAAPMALIESGLLTQLSEDLDYDVHH
DDTVHYYEKDIPTEDPDHRGMKKPRAVSAVTEKLSSQVYDYAKDGKFVLTLGGDHSIAIG
TVSGTAKAIRERLGREMAVIWVDAHADINIPETSDSGNIHGMPMAFLTRLAREEKKDIFG
WMQDEHIVNTQKLVYIGLRDVDRGEKKLLRENGIKAFSMHDIDRHGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICEAVHETGNLVAMDLVEVNPSLE
AKGASETIRAGCSLVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccttctaccatcacttcgcggttcctctcacaccctaaccagctcggcgtc
gttgccgttggtttcaatggcggccagtgcaagaagggcgtcgaagcggccccaatggcc
ctcatcgagtcaggactcctaacccaactcagcgaggatctcgactacgacgtccaccac
gacgacacagtccactactacgagaaggacatccccaccgaagaccccgaccaccgaggc
atgaagaagccacgagccgtcagcgccgtaactgagaagctcagctcacaggtctacgac
tacgccaaggacggaaagttcgtactcactctcggcggcgaccactccatcgccatcggc
accgtctccggcacagcaaaggcaatccgcgagcgtctgggccgcgaaatggccgtcatc
tgggtcgacgcccacgccgatatcaatatccccgaaacaagcgacagcgggaacatccac
ggtatgccgatggcattcctgacccggctggcccgggaggagaagaaggatatctttggc
tggatgcaggatgagcacatcgtgaacacgcagaagcttgtctatatcgggttgcgtgat
gtcgaccgtggggagaagaagctcttgcgtgagaatggtatcaaggctttcagtatgcac
gatatcgaccgtcatggtatcggtcgcgttgttgaaatggctctcgctcacatcggtaac
gacacccccattcacttgtccttcgatgtcgatgcgctggatcctcagtgggcacctagt
accggtacaccagtccgtggtggactgacgctgcgtgagggagacttcatctgtgaagct
gtgcatgagacgggaaatctggttgcgatggacttggttgaggtgaaccccagcctggag
gccaagggcgcttcggagaccattcgagcggggtgttcgttggtgcgtagtgcattgggc
gacacccttctataa

DBGET integrated database retrieval system