KEGG   Penicillium rubens: Pc13g11420
Entry
Pc13g11420        CDS       T01091                                 

Definition
(RefSeq) Pc13g11420
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pcs  Penicillium rubens
Pathway
pcs00910  Nitrogen metabolism
pcs01100  Metabolic pathways
Module
pcs_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pcs_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Pc13g11420
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     Pc13g11420
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Fer2_BFD Rieske NIR_SIR_ferr Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 8306011
NCBI-ProteinID: XP_002559560
UniProt: B6H4U6
AA seq 1086 aa
MPAMPVLDGLRYGEPVDGSPSPNHIRRQKIVIVGLGMVAISLIEKIIKQDTERKYDIVVI
GEESHVAYNRVGLSTFFEHRKIEDLYLNPAEWYDSFKERAFNYHLNTRVTAINPAEKTVQ
TSTGVTTSYDILVLATGSDATLPTHTPGYDAKGVFVYRTISDLERLIDFAAQHKGQTAVT
VGGGLLGLEAAKAMTDLEDFGNVKLIDRNKWVLARQLDGDAGTLVTRKIRELGLDVLHQK
RVKIVHTDDENNVIGITFEDGERIDCCCICFAIGVQPRDELGRDIGILCGERGGFVIDEN
LQTSIPDIYAVGECASWENQTFGIIAPGIEMADVLAFNLTNPDKQPKSFTRPDLSTKLKL
LGVDVASFGDFFADRDGPKFLPGRRPSIAPGLGGDSSREEPPVKALTYKDPFSGVYKKYL
FTMDGKFLLGGMMIGDTKDYLKLNQMVKLQKELEVPPSQFILGAQNGGEENADDLDDSTQ
ICSCHNVTKGDVVDNVKNGTCTTIAQVKSCTKAGTGCGGCMPLVQSIFNKTMLEMGQEVS
NNLCSHIPYSRADLYNIVAIKQLKSFVDIMKEVGKNPESLGCELCKPAIASILSSLFNPH
IMDKGVNDLQETNDKFLANIQRNGTFSVVPRIPGGEITADKLIAIGSVAKKYGLYCKITG
AQRIDMFGAKKQDLLNIWTELVDAGMESGHAYAKALRAIKSCVGTTWCRFGVGDSVGMAI
RLEERYKSIRAPHKFKGAVSGCVRECAEAQNKDFGLIATETGFNIFVGGNGGAKPRHAEL
LATDVPPEMVMPIIDRYLIFYIRTADKLQRTARWIENLPGGIKYLKEVIVDDKLGICADM
ERQMHELVDSYFCEWTETVKDPKRRKVFQQFSNTDETVETVEVIQERSQQRPTYWPKDSA
EREDFKGHKWSSVSWQPVVRADHFSDEPPQVSSANVKRGDTQLAVFKIKGKFYATQQMCP
HKRAFVLSDGLVGDDDAGKYWVSCPYHKRNFELNGEQAGRCSNDESMNIATFPVEERDDG
WVYIKLPPIEELDSVLGTEKWKVRKGEAEDPFHKVDKKFKGMKGKKVADGFLTRAPAVQP
AKSIDW
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgcctgcgatgcctgtgctggatggattacgatatggggagccagttgatggcagtccc
agtcccaaccatatccgacgccaaaagattgtaatagttgggcttggaatggtggctatt
tcactcatcgagaagattatcaagcaggatacggaaagaaaatacgacatcgtcgtcatc
ggcgaagagtcccacgtagcatacaaccgtgtcggactttcgacgtttttcgaacatcgc
aagatcgaggatctatacctcaatccagcggaatggtatgactcgttcaaagaacgagca
ttcaactaccacctcaacacacgagtaacagcaatcaatcccgcggagaaaacagtacaa
acctccaccggtgtcacaacatcttatgacatccttgtcctcgcaacgggttctgatgcc
accctcccaacacacacacccggctacgacgccaagggagtcttcgtatatcgaaccatc
tcagatctagaacgccttatcgacttcgcagcccagcataaaggccaaacggccgttaca
gttgggggtggtctgctaggcttagaagctgcgaaggcgatgacagatctagaggacttc
ggaaatgtcaaattgattgatcggaataaatgggtgctggcgcgacaactcgatggagat
gccgggacgttggttactcgcaaaatcagggagctgggacttgatgttctccaccagaaa
cgggtgaagattgttcataccgacgacgaaaataacgtgatcggaattacattcgaggat
ggcgaaaggattgattgttgttgtatttgctttgcgattggagtgcaaccccgagatgag
ctgggtcgggacattggcatcctgtgtggtgagcgcggtggattcgtgatcgatgaaaat
ctgcaaacctcgatcccagatatctacgccgtcggagaatgcgcaagctgggagaaccag
acattcggaatcattgccccgggaattgaaatggcggatgtgcttgctttcaacttgacc
aacccagataaacagcccaagagtttcacacggccggatctcagcacaaagctgaagctg
ctcggagttgatgtcgctagtttcggtgatttctttgccgacagggacggaccaaagttc
cttcccggtcgtcgaccttccattgcccctggcttgggaggggatagttcacgagaggaa
ccccctgtcaaggccttgacgtataaagacccgtttagtggagtatataagaagtatttg
ttcaccatggacggcaaattcttgcttggtggcatgatgattggagataccaaagactat
ctgaagttgaatcagatggttaagctacagaaagaactcgaggttcctccgagtcaattt
atccttggtgcacagaatggtggggaggaaaatgcggacgaccttgatgacagcacccag
atctgttcatgtcacaatgtcaccaagggagacgtggtcgataatgtgaagaacggcaca
tgcacaacaattgcacaggtcaagtcatgcaccaaagcaggaacaggctgtggtggttgc
atgcctcttgttcagtcgatcttcaacaagacaatgctcgaaatgggacaagaggtatcg
aacaacctgtgctcacatatcccctactcccgagccgatctgtacaacatcgttgcgatc
aagcaactgaaatccttcgtcgatatcatgaaagaagttgggaagaatccagaatctctc
ggctgcgaactctgcaagcccgctattgcatccattctatccagtctgttcaatccgcac
atcatggacaagggagtcaacgacttgcaggaaacaaacgacaagttccttgccaacatc
caaagaaacggcacattctctgtggtgccccgaattccaggtggtgaaatcacagccgat
aagctcattgctattggttccgtagccaagaaatacggcctttattgcaaaatcaccggt
gcccagcgcatcgacatgttcggtgcaaagaagcaggatcttctgaatatctggacggaa
ctcgttgatgcgggtatggagagtggacacgcctatgcaaaggctctccgagcaatcaag
agttgtgttggaaccacatggtgtcgtttcggtgtgggtgacagtgtcggcatggcaatt
cgactggaagagcgatacaagagtattcgtgcgccacacaagttcaagggagctgtatct
ggctgcgtgcgagaatgtgccgaggcccaaaacaaagacttcggactcattgccacggaa
accggattcaacatctttgttggaggcaacggaggcgcaaagcccagacacgccgaactc
ctcgctacagatgtaccaccggagatggtgatgcctataatcgaccgctacttgatcttc
tacatccgcaccgccgacaaactgcagcgaacagcacgatggatcgagaatctccccggc
gggatcaaatacctcaaagaagtgatcgtggatgacaaactcggaatctgcgccgacatg
gaaaggcaaatgcacgaactagtcgatagttacttctgcgagtggaccgagactgtcaaa
gatcccaagcgccgaaaagtcttccaacaattctccaacacagacgaaaccgtcgagacg
gtagaagtcattcaagaacgatctcagcaacgacccacatactggcccaaggactctgcc
gagcgcgaggatttcaaaggtcacaagtggtcgagtgtctcctggcagccggttgtccga
gcagatcatttctccgatgagccgcctcaagtctcatcggcgaatgtcaagcgtggagat
acacagcttgctgtcttcaagatcaagggcaagttctatgcgacgcagcagatgtgtccg
cacaagcgagcctttgttctttccgatggtcttgttggtgatgacgatgccgggaaatat
tgggtgtcgtgtccgtatcacaagcgcaactttgagctcaatggggagcaggcgggtcgg
tgctcaaatgatgagagtatgaatattgctacgttccccgttgaggagagggacgatggc
tgggtatatatcaagcttccgccgattgaggagttggattcggtcctggggacggagaag
tggaaagttcgtaagggtgaggcggaggatcctttccataaggtcgataagaagttcaag
ggtatgaaggggaagaaggtggctgatggtttcttgacccgtgcaccagcggtgcagccc
gccaagtcgattgactggtga

DBGET integrated database retrieval system