KEGG   Penicillium rubens: Pc13g13140Help
Entry
Pc13g13140        CDS       T01091                                 

Definition
(RefSeq) Pc13g13140
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pcs  Penicillium rubens
Pathway
pcs00860  Porphyrin and chlorophyll metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pc13g13140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcs01007]
    Pc13g13140
Enzymes [BR:pcs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Pc13g13140
Amino acid related enzymes [BR:pcs01007]
 Aminotransferase (transaminase)
  Class III
   Pc13g13140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 8311420
NCBI-ProteinID: XP_002559728
UniProt: B6H3A6
AA seq 432 aa AA seqDB search
MDSALRDAATRFIEQHPESQRLHKLSLASLPGGNTRTLLHTAPFPVFMRKGEGSVLWDED
GNKYYDLVGELSAGLYGHSHPTLQKVLTETIQNVGLSLGATNVYEQRYASLLCERFGLER
ARFTNSGTEANIHCLAAARKFTGRRKVIVFRGAYHGSVLSFGNGIPENNIDQSDWVLLQY
NDSEAVREAFSQNDDIAAVILEGIQGAGGFISASLEFLRTTREESERAGALMILDEVMTS
RLAPGGLKDMLGIRPDLITLGKYLGGGLPFGAFGGRRDIMDVFNPLTPGALAHSGTFQNN
TLMLHSGYAGLSEVYTAEVVQSLNAQGDDLRQRLQRVFAGSKFCVTGQGSLMCVHATNVG
LRAEQITCRDDVVAIEDTDLKQLFWLELVNAGFWVQSRGTITLNIAMSAAALDAFVEVVE
EFCKRYRSLIVV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggactcagctctccgcgatgccgcaactcgattcattgagcagcaccctgagtcgcaa
cgcctgcataagctgtcactcgccagcttaccaggaggaaacacccgcactctactacac
acagcaccatttccagttttcatgcgcaagggcgaaggttcagtattgtgggatgaagac
ggaaacaaatattatgatctagtcggcgaattatccgccggactatatggacactctcac
ccgacgctacaaaaagtgttgacagaaaccattcaaaatgtcgggttgagtctgggagca
acgaatgtctacgagcagcgatatgcgtcgttgctgtgtgagcggtttggacttgaacgg
gctcgatttacaaactctggaacagaagcaaacatacactgtcttgctgcagccaggaaa
ttcaccggccgtcgtaaggttatcgtcttccgaggagcctaccacggtagcgtgctatct
tttggaaatggtatcccggaaaacaacatcgaccagagtgattgggtactcctgcagtac
aacgattccgaggctgttcgggaagcgttttcccagaatgatgatattgccgctgtcatt
ctagagggaatccagggggctggcgggttcatttctgcatcactcgagttcctacgaaca
acccgcgaggagagcgagagagcgggcgcgttaatgattctggatgaggtgatgacatct
cggctggcaccggggggattgaaagatatgctcgggatcagaccggatcttatcactttg
ggcaagtatctaggcggaggcttgccatttggggctttcggtggtcgacgagatattatg
gatgtgttcaaccctcttacgccaggggctttggcacactctggcacattccagaataac
actttgatgttgcactctggatatgcgggactctctgaagtgtatacggctgaagttgtt
caatcgctcaatgctcaaggtgatgacttgcgtcagcgcctgcaacgggtctttgcggga
tcgaagttctgcgttactggccagggttctcttatgtgcgtccatgccactaatgtaggt
cttcgcgctgagcagatcacttgtcgagatgatgttgttgccattgaggacacggatctc
aagcagcttttctggttggaactggtgaatgcagggttctgggttcagagccgaggaaca
atcaccttgaacatcgccatgtctgctgcagctcttgacgcatttgttgaagtcgttgag
gagttctgcaagcgatatagatccttgattgtagtttaa

DBGET integrated database retrieval system