KEGG   Penicillium rubens: Pc15g01110Help
Entry
Pc15g01110        CDS       T01091                                 

Definition
(RefSeq) Pc15g01110
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
pcs  Penicillium rubens
Pathway
pcs00680  Methane metabolism
pcs01100  Metabolic pathways
pcs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Pc15g01110
Enzymes [BR:pcs01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     Pc15g01110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr DXP_synthase_N E1_dh Transketolase_C TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 8312521
NCBI-ProteinID: XP_002560336
UniProt: B6H6Q5
AA seq 738 aa AA seqDB search
MAPALELLEKPAQYLPVKAVSAIGKGDATGLRLESPEKHERVMNVFRAFIADLCQQYGEG
HAGSPMGMVAIGISLYKYVMKYSPNNCNYFNRDRFVLSNGHACLWQYLFMHLVGVKSMTL
EQLKSYHSSKLDSVCPGHPEIENEGIEVTTGPLGQGLASAVGLAMATKNLAATYNKPGHE
LVNNMTWCMVGDACLQEGVGLEALSLAGHWKLNNLCVIFDNNSVTCDGTADIANTEDINT
KMRATGFNVVDVYNGNSDVAEITNALLAAKLSDKPTFLNVRTTIGYGAAKAGTADIHGAA
LGVEEVANFKRRFGLNPDEHFHIPQDVYDFFSDIPGRGDAHEAGWQNALVKYQNEDPALA
AEFALRVAGKMPEDWTKCIPRTEDQPTAPTATRKSAGIVTNNLAVNINSVLVGTADLTPS
VNVAYKNKVDFQSPELQTACGLNGNYSGRYIHYGIREHAMCSISNGLSAFNKGTFIPMTS
TYFVFHLYAAAGVRMAALQGLQQIHIATHDSIGVGENGPTHQPIAVAALYRAMPNVLYIR
PCDAEEVAGAYIAAIQATETPTVISLSRQSLTQYPKNSSREGTLKGAYVFAEAEGDDFDV
SLIGVGSEMGFAMQTRELLLNEHGIRARVLSFPCTRLFEQQSREYKQSVLKSRAGKPTVV
IEAYPSNGWERYADASVSMNSFGKSLPSKETYEHFGFAPESIAPKVKGLVEEVRRDGIGI
LRGDFRDFNGSLRIGVEH
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgcgctagaactcctcgagaagcccgcacagtacctgccagtaaaggcggtc
tcagcgatcggcaaaggagatgctactggactcagattagagagcccggagaagcatgag
cgggtgatgaatgtcttccgagctttcatcgctgatctctgccagcagtatggtgaaggc
catgctggatctccaatgggcatggttgcaattggcatttccctgtataagtatgtcatg
aagtattctccgaacaattgcaactacttcaaccgggaccgcttcgttctctcaaatggc
cacgcctgtctgtggcaatacctctttatgcaccttgttggcgtcaagagcatgacactc
gaacagctcaagtcttaccactcaagcaagctcgactcagtctgtcccggccaccctgaa
attgagaatgagggcatagaggtcacaactgggccccttggccagggtctcgccagtgct
gttggcctggccatggccactaagaaccttgccgcgacttacaacaagcccggccatgag
ctagtgaataacatgacatggtgcatggtgggcgatgcttgcctgcaggaaggtgtcggt
ctcgaggcgctgtccctcgctggtcactggaagctaaacaatctctgtgttatcttcgac
aataactcagttacgtgtgatggaactgcagatatcgccaacactgaggatatcaacacc
aagatgcgggccactggctttaacgtagtagacgtgtacaacggaaactcggatgttgct
gaaatcacaaacgctcttcttgccgctaaattaagcgacaagcccaccttcctcaacgtt
cgcactactattggctacggagctgccaaggccggaaccgctgacatccacggagctgca
cttggagtcgaggaagtggctaacttcaagaggaggtttggcctcaaccctgacgagcat
ttccacattcctcaagacgtctatgacttcttcagtgacatccctggacgtggtgacgca
cacgaagcgggatggcaaaacgccctggtgaagtatcagaatgaagatcccgctctggcg
gctgaatttgcgctccgtgtcgcgggcaagatgcccgaagactggaccaaatgcattccc
cgcacagaagaccagcctactgcgccaacagccacgcgaaagtcagccgggatagtgacc
aacaaccttgcagtgaatatcaattcagtcttggtcggaacagcggatcttactccctcg
gtcaatgtcgcctacaaaaacaaagttgacttccaatctcccgaactccaaactgcttgc
ggcctgaacggaaactacagcggtcgctatatccactacggtatccgcgagcacgccatg
tgctccatctccaacggactttctgcattcaacaaaggcacatttatccccatgacgagt
acctactttgtcttccacttgtacgctgctgccggtgtacgcatggccgcgcttcaaggc
ctccagcagatccacatcgccacccatgacagcattggagtcggtgagaacggacctaca
caccaacccattgccgtcgccgctctctaccgcgcgatgcctaatgttctttacatccgg
ccatgcgacgcagaagaagtggccggtgcctacattgctgccatccaggccactgagacg
cctactgttatctcactctcccgacagagtctgacacaataccccaagaactcttcgcgc
gagggcacgctcaagggcgcatacgtcttcgccgaggctgagggcgatgattttgatgtt
agcttgatcggagtcgggtctgagatgggcttcgcgatgcagactagggaattgctgctt
aacgagcatggtatcagggcacgagtcctgtccttcccttgcactaggttatttgagcag
cagtcgcgggagtacaaacaatcggtcttgaagtcgcgggctggaaagcccactgttgtg
atcgaggcgtatccgtccaacgggtgggagcgctatgctgatgcttcggtgtcgatgaac
agctttggaaagagccttccttcaaaggagacatatgagcactttggatttgcaccggag
agtatcgcacctaaagtcaagggcctagtggaggaagtcaggagagacggcatcggaatc
ttgaggggtgactttagggattttaacggtagccttcggattggtgttgagcattag

DBGET integrated database retrieval system