KEGG   Penicillium rubens: Pc15g01230
Entry
Pc15g01230        CDS       T01091                                 
Name
(RefSeq) Pc15g01230
  KO
K11294  nucleolin
Organism
pcs  Penicillium rubens
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pcs03009]
    Pc15g01230
   03036 Chromosome and associated proteins [BR:pcs03036]
    Pc15g01230
Ribosome biogenesis [BR:pcs03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    Pc15g01230
Chromosome and associated proteins [BR:pcs03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     Pc15g01230
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 8312533
NCBI-ProteinID: XP_002560348
UniProt: B6H668
AA seq 507 aa
MSKTSTKGADKANKASKALNKVKDAGVTKASQSPAAKSKAIASKVASKEKASKKNKKKEP
TPSSSESESESDEDMKDASSSSSSESESEEEKPAPKKTEKKTEKKVEKKVAAKAESSDSS
DSSDSESESEEEKPAPKKTEKKAAAKAESSDSSDSDSDSESESEEEKPAPKKAEKKVAAK
AESSDSSDSESESESEAKKASSDSESGSDSDSSDSDSDSEETPVSKKRKADEEPAAAAKK
SKTEDAPEGASANLFIGNLSWNVDEEWLQREFSEFGELSGVRIVTDRESGRSRGFGYVEY
TSAADAAKAMEAKKGTDLDGRTINLDYAAPRQANPQQDRTQDRARSYGDQTSPESDTLFV
GNLPFSATEDALHEVFGAHGSVLGIRLPTEQETGRPKGFGYVQFSSIDEAKAAHGALNGH
ELEGRAVRLDFSTPRPAGGDRGGFGGRGGGRGGGRGGFGGRGGGGFGGRGGGGRGGRGGF
GDRGGRGGALNKGKGSIPEYKGTKVTF
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtccaagacatctaccaagggtgccgataaggccaacaaggccagcaaggccttgaac
aaggtcaaggatgccggtgtcaccaaggcttcccagtcccccgctgccaagagcaaggct
attgccagcaaggtcgcctccaaggagaaggcctccaagaagaacaagaagaaggagcct
actcccagctcctccgagtccgagtctgagtccgatgaggatatgaaggatgcttcctcc
agctcaagctccgagtctgagtctgaggaggagaagcccgctcctaagaagaccgagaag
aagaccgagaagaaggtcgagaagaaggtcgctgctaaggctgagtcttccgactcttcc
gactcttccgactctgagtctgagtccgaggaggagaagcccgcccctaagaagaccgag
aagaaggctgctgctaaggctgagtcttccgactcttccgactctgactctgactccgag
tccgagtccgaggaggagaagcccgctcctaagaaggccgagaagaaggtcgctgctaag
gctgagtcttccgattcttccgactctgagtctgagtccgagtccgaggccaagaaggcc
tcttccgactccgagtctggttccgactctgacagctctgactctgactctgactctgag
gaaacccctgtctccaagaagcgcaaggctgatgaagagcctgccgccgctgccaagaag
tccaagaccgaggatgctcccgagggtgcttccgccaacctgttcattggtaacctgtcc
tggaacgtcgacgaggagtggctccagcgtgagttctccgagttcggtgagctctccggt
gtccgcatcgttaccgaccgcgagtctggccgctcccgtggtttcggctacgttgagtac
accagcgctgccgatgccgccaaggccatggaggccaagaagggtactgatcttgatggc
cgcaccatcaacctcgactacgccgctccccgtcaggccaacccccagcaggatcgtacc
caggaccgtgctcgttcctacggtgaccagaccagccccgagagcgacactctcttcgtt
ggcaaccttcccttcagcgctactgaggatgctctccacgaggtcttcggcgcccacggc
tccgttctcggaatccgtctccccactgagcaggagaccggccgtcccaagggcttcggt
tacgttcagttctcttccatcgatgaggccaaggctgcccacggtgctctcaacggccac
gagctcgagggccgtgccgtccgtctcgacttctctactccccgtcctgccggtggtgac
cgtggtggcttcggcggccgtggtggtggtcgcggcggtggccgtggtggcttcggcggt
cgcggtggtggtggtttcggtggacgtggtggtggtggtcgcggtggccgcggtggcttc
ggtgaccgtggcggccgtggtggtgcccttaacaagggtaagggctccatccctgagtac
aagggtaccaaggtcaccttctaa

DBGET integrated database retrieval system