KEGG   Penicillium rubens: Pc16g05710Help
Entry
Pc16g05710        CDS       T01091                                 

Definition
(RefSeq) Pc16g05710
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pcs  Penicillium rubens
Pathway
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Pc16g05710
   00500 Starch and sucrose metabolism
    Pc16g05710
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Pc16g05710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 8314372
NCBI-ProteinID: XP_002560910
UniProt: B6H8G5
AA seq 580 aa AA seqDB search
MESHRTRPSLHFTANCWINDPCAPGYDAATGLYHVFYQCNPHGTEWGSMSWGHLISEDLI
HWTPFTKPALIPDQPYDRDGVFTGCMAPPENSETGSLKVIYSSVRHLPFHWSTPPYPRDA
AGLAIAESRDNGKTWTKLSENPILAGEPQGTQVTGFRDPFLAEWHALNDLRGQNSMYGLV
SGGIEGHGPTAFLYSVPHRNVSEWHYLSPLVNIPARFQPSQKWSGNFGINWECVNFLTLE
AGSNSRVCLILGAEGDIEREHIRNHKGDAHIPPRTVRSLLWMFGDLRVENNVPRFEYTHG
GYLDCGSLYAANSFLDPVSKRHIMHAWIPEEDIPASYAKDKGWNGALAIPRELFLVSISN
VTRALYSPLSEISSVEQVPNQDGSATIYTLGIRPVEEIVRLRKRHRHSCQQKYISLPPTA
GASHALCSTSSTTWVLEAEIAINPSCCFEVGFHIRHNSDMSIRTMIMFSPQEETISVNKS
RSTSDPNIRNCPEQGPFTLFYKTDCLGVQPKDKLETLRIHIISDADTLEVFANDRFALAT
MVYSPDIRPAGISVVAKGEQGSAVIEEVNIWEGLPSARKV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccatcgcacccggccctctctgcacttcaccgcaaactgctggatcaacgat
ccttgtgctcccggttacgatgcggccacgggcttataccatgtcttctatcagtgcaat
ccacatggtactgaatggggctcgatgtcttggggtcatctcatcagcgaagatctcata
cactggacaccctttaccaaacctgctctgattccagatcagccttatgatcgtgatggg
gtctttacaggctgcatggcaccacccgaaaactccgagacagggtctctgaaagttatc
tactcatcagtgcgccacctaccatttcactggagcacacctccgtatccacgcgacgct
gctggtctagcaattgccgaatccagggacaatggaaagacatggacaaaactttcggaa
aatccaatcttagctggtgagccccaggggactcaagtgactgggtttcgtgaccccttc
ttagcagagtggcatgctttgaatgatcttcgtgggcagaattccatgtacgggcttgtt
tcaggtggaattgaaggccacggaccgacagcgttcctatactctgtgccgcataggaac
gtatctgaatggcactatctgtctcctttggtcaatatacctgctcgatttcagccctcg
caaaaatggtctgggaatttcggcatcaactgggaatgcgtgaatttcctgaccctcgaa
gccggcagcaacagccgcgtgtgtctcatcctgggagcggagggagacatagaacgtgaa
catatccggaatcataaaggtgatgcgcatattcccccaaggactgtccgttctctactg
tggatgtttggtgacttgagggttgaaaacaacgtccctcgctttgagtacacccatggc
gggtatttggactgcgggtcactatatgcagccaattcatttctcgatccggtgtctaag
agacatataatgcacgcatggataccggaagaggacataccagcaagttatgccaaggac
aagggatggaatggcgcattggctattccgcgcgagctctttctcgtttctatctcaaat
gttactcgagctctttacagtcctttgtcagagatatcgtctgttgaacaagttccaaac
caagatggttcagccactatctacactctcgggatacgacctgtcgaagagatagtccga
ctccgcaaacgccatcgtcattcttgccaacagaaatatatctcgctcccaccaacagcg
ggagcatcacacgcactgtgctcgacatcctctactacctgggttctcgaggcagaaatc
gctatcaacccgagttgctgctttgaagtcggttttcatatccgccacaatagtgatatg
tctatacgcactatgatcatgttttctcctcaggaagagaccatcagcgtcaacaagtcg
agatcgacatctgatccaaacatacgcaattgccccgaacaaggcccgtttactctcttc
tacaagactgattgtctgggggtccaacccaaagacaaattggagaccttgcggattcac
ataatctccgacgcagataccttggaggtcttcgcaaacgatcggtttgccttggctacg
atggtctattctccggacattcgtcctgctggcatatcagtggttgccaaaggggaacag
gggagtgcagttattgaagaggtaaatatatgggaggggttgccatctgctcggaaagta
tga

DBGET integrated database retrieval system