KEGG   Penicillium rubens: Pc16g07300Help
Entry
Pc16g07300        CDS       T01091                                 

Definition
(RefSeq) Pc16g07300
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
pcs  Penicillium rubens
Pathway
pcs00564  Glycerophospholipid metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pc16g07300
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Pc16g07300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH DDE_Tnp_2 EcKinase
Motif
Other DBs
NCBI-GeneID: 8311019
NCBI-ProteinID: XP_002561058
UniProt: B6H7H2
AA seq 423 aa AA seqDB search
MQWMRRLGTRTLTPVPLTLSKDKVPTKKDVRDIVGAFLTEEWPSVDPETLTVSYYASFAN
AHCPVKRPKPATGPSTETLKVFIKFHNDAGGCLEIFKPLAPTKHEEALLCYEYGRTGLGA
KVYGFFKTQDGTLGRIEEFLDARNMEPEDVENSVIRADVAKGLAMFHVLKTSLKKKAVKS
YYEAVINGLENYHKLNKLKVLGKEGGVSIDKIVDYDYGRRLRNVMDKLESIGGKTGWCIH
DIQFMNVMVKNDPKKGESKVILIDFEFVMQNYRAFDIGGHFMQKMFKWFDEESRIAGCRK
YTEEEKRHFCDEYARQWNKLTGDSDTGDQVFLESEYGYLLAITFDIHNMLCFMLEPGSCD
LAGCLFVQASHAYLDPAGRALIGSLYPNPNLLRKEPALIELCALEARNHEWTTDNPDRER
YKF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggatgaggcgtcttgggacgaggaccttgactcctgttcctctgactctttcc
aaagacaaagtaccgactaaaaaggacgtcagggacattgtcggcgcattcctgacggaa
gaatggccatctgtggatccagagaccctgaccgtgtcatactatgcatcatttgccaac
gcccactgtcccgtgaagcgaccgaagcccgctactggcccatctactgaaaccttgaag
gtgtttataaaatttcacaatgacgccggggggtgcctcgaaatattcaagcctctggca
ccaaccaagcatgaggaagcacttctctgctacgaatacggtcgaaccgggctgggagcc
aaggtctatggtttcttcaaaacacaggatggcacactcgggagaatcgaggagttcctg
gatgcacgtaacatggaaccggaggacgttgagaattcagtcattcgagcggatgttgct
aaaggactggcaatgttccatgtcttgaaaacgtcactgaagaaaaaggcagtaaaatca
tattatgaagccgttatcaatggactcgagaactaccacaagttgaataagttgaaggta
cttgggaaagaaggaggtgttagtatcgataaaatagttgactacgactatgggaggagg
ctgagaaatgtgatggacaagctggaatctataggaggaaagacaggatggtgtattcat
gacatccaattcatgaacgtgatggtgaaaaatgatccgaagaaaggtgagagcaaagtc
attctgattgactttgagttcgtgatgcagaactaccgagcatttgacatcggtgggcac
ttcatgcaaaagatgttcaaatggtttgacgaggagagcagaatagcaggttgcaggaaa
tatacagaggaggagaagagacacttctgtgacgagtatgctagacagtggaacaaactg
acaggtgattcagataccggggatcaggtgttcctggaatctgaatacggatatttgttg
gccatcacttttgacatccataacatgctttgcttcatgttggagcctgggtcatgtgac
ctggctggctgcctgtttgttcaggctagtcatgcctatctggatcccgcggggagagct
cttatcggctccctataccctaaccctaacctattacgtaaggaacccgccttaatcgaa
ctttgtgcgctagaagcgcgaaatcacgaatggactacggataacccagatcgagaacgt
tataaattttaa

DBGET integrated database retrieval system