KEGG   Penicillium rubens: Pc18g01780Help
Entry
Pc18g01780        CDS       T01091                                 

Definition
(RefSeq) Pc18g01780
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcs  Penicillium rubens
Pathway
pcs00480  Glutathione metabolism
pcs00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pc18g01780
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pc18g01780
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pc18g01780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Ral 40S_S4_C
Motif
Other DBs
NCBI-GeneID: 8314241
NCBI-ProteinID: XP_002562022
UniProt: B6HCJ9
AA seq 189 aa AA seqDB search
MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYQELKAQYP
EDFTIVGFPCNQFGSQDPGSDDEIQSFCQLNYGVTFPVLGKLDVNGDNAAPVWTFLKEQQ
PGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDTIVKEIEKAKKEGTLASLKSE
AGAEQAKLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctacatctttcttcgattttgagcctgtcgacaaaaagggtgcccccttc
cccctttcttcgctgaacggcaaagtcgtgctagtcgtgaacacagcctcaaaatgcggc
ttcacgccccagtttgaaggcctggagaaactctaccaggagctgaaggcccagtacccc
gaagacttcaccatcgtcggattcccatgcaaccagttcggcagccaggaccctggctct
gacgatgagatccagtccttctgccagctcaactacggcgtcaccttccccgtgctcgga
aaactggatgtgaacggcgataacgctgcacctgtgtggactttcctgaaggaacagcag
cctgggatcatgggcatgaagcgcgtcaagtggaactttgagaagttcctcgtctccgcc
gatggaaaggctgttaaccgctgggcttctcttaccaagcccgagggacttaaggatacc
attgttaaggagatcgagaaggcgaagaaggagggcactcttgcttcgctgaagagtgag
gctggtgctgagcaggctaagctgtcgtag

DBGET integrated database retrieval system