KEGG   Penicillium rubens: Pc18g01940Help
Entry
Pc18g01940        CDS       T01091                                 

Definition
(RefSeq) Pc18g01940
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
pcs  Penicillium rubens
Pathway
pcs00460  Cyanoamino acid metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc18g01940
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Pc18g01940
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Pc18g01940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-GeneID: 8314256
NCBI-ProteinID: XP_002562038
UniProt: B6HCL5
AA seq 865 aa AA seqDB search
MKFAWFEVAALTASVANANSLAYSPPYYPSPWMTGEGDWSEAYTRAVEFVSNLTLAEKVN
LTTGSGWMQESCVGETGGIPRLGMWGMCMQDAPLGIRFSDYNSAFPAGVNVAAAWDKRLA
YQRGVAMGEEHRDKGVDVQLGPVAGPLGKFPDGGRNWEGFSPDPVLTGVMMAETIKGMQD
AGVIACAKHFIGNEQEHFRQSGEAQGYGYNISQSLSSNIDDKTMHELYLWPFVDSIRAGV
GSVMCSYNQINNSYGCANSYSLNKLLKGELGFQGFVMSDWGAHHSGVESALAGLDMSMPG
DVILGSPYSYWGTNLTISVLNGTMPEWRVDDMAVRIMSAYYKVGRDRFRTPPNFSSWTRD
EYNFQHSMVSEDWGKVNERVNVQRDHAQIIRKIGSDSTVLLKNKGGALPLTHNEKFISIL
GEDAGSNAHGANGCDDRGCDNGTLAMGWGSGTANYPYLITPEQAIQNEALEYSNGQTNVF
AVTDNWALTQMAALASQADVALVFVNADSGEGFINVDGNEGDRKNLTLWKNGEEVIKTAS
QHCNNTIVVIHSTSAVLISDWYDNDNITAIIWAGLPGQESGHSLVDVLYGRINPGGKTPF
TWGKTRKDYGPPLVTVPNNGADAPQDNFEDGVFIDYRRFDKDNIEPIYEFGYGLSYTKFA
FSDIKVTPLASSQRGEYKATTGKSQKAPVLGEPSTVSDNLFPEGIKRVRQYLYPWLNSTD
LRASSGDPDYGMDSKDYLPEGATDGSPQDLLPSSGSSGGNPGLFEDLYQVTATITNTGSV
TGDEVPQLYLSLGGNDDPTKVLRQFDRVTIAPGQSLQWTTTLTRRDVSNWDVASQNWVIS
GAQKKVYVGNSSRKLPLSADLPSVE
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcgtggtttgaggtggccgccttgacggcctcagtggccaatgcgaattcc
ctggcctattctcctccatactatccctccccatggatgactggcgagggcgactggtcc
gaagcatacacacgcgccgttgaatttgtctctaatttgacgctggccgagaaagtcaac
ttgacaaccggttctggctggatgcaagaaagttgtgttggtgagaccggtggcattccc
cgacttggcatgtggggaatgtgtatgcaggacgcaccgttgggtatacgctttagtgat
tacaactccgctttccccgcgggtgtcaatgttgccgcagcatgggacaagcgacttgcc
taccagcgaggtgtggcaatgggcgaggaacaccgcgacaaaggtgtggatgtgcaattg
ggtcctgttgctggccctctgggcaagttcccggacggtggtcgtaactgggaaggcttc
tcgcctgaccccgttttgactggtgtgatgatggccgaaaccatcaagggtatgcaggat
gctggtgtcattgcttgtgctaagcatttcattggaaatgagcaggagcacttccgccag
tctggcgaggctcagggatacggatacaacatctcccagagtttgagctcaaacattgac
gacaagactatgcacgaactgtacctctggcccttcgtggactccatccgtgctggtgtt
ggctcggttatgtgctcttacaatcagatcaacaacagctacggctgtgcaaacagctac
tccctcaataagctgctcaagggcgagttgggcttccagggctttgttatgagcgactgg
ggtgcgcatcacagcggcgtcgaatctgctctggccggtctggatatgtctatgcccggt
gatgtcattcttggtagcccttactcctactggggaaccaacctgaccatctccgttttg
aacggtactatgcctgaatggcgtgtcgatgacatggctgtccgcataatgtctgcttac
tacaaggttggacgtgaccgcttccgcactcctcccaacttcagctcctggacccgtgat
gagtacaacttccagcactccatggtcagcgaggactggggtaaggtcaacgagcgcgta
aatgtccagcgcgatcatgcccagatcatccgcaagattggctctgacagcactgtcctg
ctcaagaacaagggtggcgcacttccccttacccacaatgagaagttcatcagcattctg
ggagaggacgcaggctccaatgctcatggcgccaatggctgcgacgaccgtggttgtgat
aacggaactttggccatgggctggggtagtggaactgctaactacccatatctgattaca
cccgagcaagccatccaaaacgaagctctggaatacagcaacgggcagactaacgtcttc
gctgtgactgataactgggccctcacccagatggctgcccttgcttcccaggctgatgtt
gccctggttttcgtgaacgccgactctggcgagggatttatcaacgtggacggcaacgag
ggtgaccgcaagaacctgactctctggaagaacggcgaagaggtgattaagactgctagt
caacactgcaacaacactatcgtcgtgatccacagcacgtccgctgttctgattagcgat
tggtatgacaatgacaacattaccgccattatctgggctggcttgccaggccaggagagc
ggtcacagcttggtggacgtactgtacggtcgcatcaaccccggcggtaaaactccattc
acctggggtaagactcgcaaggactacggccctcctcttgtcacagtgcccaacaacggc
gccgatgctcctcaagataatttcgaggatggtgtcttcattgactatcgccgtttcgac
aaggacaatatagagcccatttacgagttcggttacggcctaagctacaccaaatttgcc
ttctccgacatcaaggtcacccctcttgcctcatcccaacgcggcgaatacaaggccacc
actggaaagagtcaaaaggctcccgttcttggcgaacctagcacagtctcagataacctg
ttccccgagggaatcaaacgtgtccgccagtacctttacccgtggttgaactccaccgac
ctgcgtgcctcgtccggtgatcctgactacggcatggactccaaggactaccttcctgag
ggtgctaccgatggttctccccaggaccttctcccctctagcggaagctccggcggcaac
cctggtctgtttgaagacctttaccaggtgaccgctactatcaccaacaccggctccgtg
actggtgatgaggttccccagttgtacctttccctcggcggcaatgatgaccccacaaag
gtcctacgccagtttgaccgagtcaccattgctcctggccagagtctccagtggactacc
accctgacccgccgtgatgtctccaactgggatgttgcctcccagaactgggttatttcg
ggcgcccagaagaaggtgtatgtcggcaactcatcccgcaagttacctctttcggccgac
ttgccctcggttgagtaa

DBGET integrated database retrieval system