KEGG   Penicillium rubens: Pc18g02000
Entry
Pc18g02000        CDS       T01091                                 

Definition
(RefSeq) Pc18g02000
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pcs  Penicillium rubens
Pathway
pcs00100  Steroid biosynthesis
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Module
pcs_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Pc18g02000
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Pc18g02000
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8314262
NCBI-ProteinID: XP_002562044
UniProt: B6HCP5
AA seq 495 aa
MAEKHSKKIPVQPVPEKRGYEFGGPLGAFGIVFGLPILIYVFTFVCNDISGCPAPSLLNP
STLSLEQLKREAGWPDQGVTALYDTNVTLWTLSYYAFSLFLQVFLPGQEADGVVLACGGR
LKYKFNAFPSAIIILSGLAGGTYLYGADFVVWTFLWDNYVQVITANILISSFIALFVYTK
SFTVPAPGQATPSLRQLAPGGHTGNMLYDFFIGRELNPRVCLPIPFVSEASRTIDIKVFM
EMRPGLLGWTILNLSNVAHQYRTYGYITDSIVLVTVFQAFYILDALYMEPAIMTTMDVIM
DGFGFMLSFGDVVWVPHVYSIQTRYLSVFPYELGLSGMAVVLGITAVGYLIFRGANNQKN
RFRTDPNDPRVKNIKYIETAAGSKLMISGWWGLARHINYLGDWTMSWAYCLPTGVAGYVL
IESINPASGIVQKQAVQTPEVRGWGMIFTYFYMLYFGILLIHREMRDEEKCEKKYGADWK
RYTSIVRSRIIPGIY
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggctgagaagcattccaaaaaaatacccgtgcagccagtgccggagaaacgcggttat
gagtttggtggaccactaggtgctttcggtatcgtgtttggactgccaatcctgatttat
gtcttcacctttgtctgcaacgatatctctggttgtcctgcaccatcgttgctgaacccc
tcaactttgtcgctcgagcaattgaagcgtgaagcgggttggccagaccagggagtcacg
gcgctttatgacaccaatgttacactgtggacactgagctactatgccttcagcctgttc
ttgcaggtcttccttcccggtcaggaggcagacggtgttgtgttggcctgcggaggacgg
ctgaagtacaaattcaatgcattcccctctgccatcattatcctctcgggcctcgccggg
ggtacctatctctacggagccgactttgtggtgtggacattcctatgggacaactatgtt
caggtcattacagcaaacatattgatctcttcttttatcgcgctgtttgtctacacgaag
agcttcacagttccagccccgggccaggcaaccccaagcctacgacagctggcacctggc
ggccatacgggcaacatgctctacgacttcttcatcggccgtgagctcaacccccgtgtt
tgcctgcccattccatttgtcagtgaggcatcgcgcaccattgatatcaaggtgtttatg
gagatgaggccaggcttgcttgggtggacaatcctgaacctgtccaatgtggcccaccag
taccgaacctatggctacatcactgactcgatcgtgctggtcaccgtcttccaggcattc
tacatcctggatgcgctatacatggaaccggcaatcatgactaccatggacgtaatcatg
gacggattcggattcatgttgtctttcggcgatgtggtttgggtgcctcatgtgtacagc
atccagacccgatatctctctgtcttcccttacgagcttggcttgagcggtatggctgtt
gttctgggtatcacagccgtcggatatttgatcttccgcggcgccaataaccagaagaac
cgtttccgcacggatccaaatgacccccgcgtgaagaacatcaagtacatcgaaactgct
gctggatccaaactgatgatctccggctggtggggtctcgcgcgtcacatcaactacctg
ggcgactggaccatgtcgtgggcgtactgtctgccaactggtgtcgcgggatatgttctc
attgagagcatcaacccagccagtggcattgtccagaagcaagccgtgcagaccccagaa
gtccgtggctggggtatgatcttcacgtacttctacatgctctacttcggtatcttgttg
atccaccgtgagatgcgtgatgaggaaaagtgcgagaagaagtacggtgctgactggaag
cgttatacctccatcgtccgcagccgtatcatccctgggatctactga

DBGET integrated database retrieval system