KEGG   Penicillium rubens: Pc18g04070Help
Entry
Pc18g04070        CDS       T01091                                 

Definition
(RefSeq) Pc18g04070
Organism
pcs  Penicillium rubens
SSDB OrthologParalogGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-GeneID: 8306883
NCBI-ProteinID: XP_002562243
UniProt: B6HBH1
AA seq 565 aa AA seqDB search
MASENEITALAVHSSKEDPATFAPESPGVANKDEGLYAETTTNRRNPVGSRLGSVIRAFE
NQLIEYNLEARGIERVAADERMKRNTWMSYLQVSLLWISINLAPNNITLGMLGPAVYGLS
FRDSALCAVFGAFVGSFVASWMATWGPVSGIRTLAFGRYSMGWWPSKIIVVLNLIQMIGY
GLIDCVVGGQILSAVSPGGMSVAVGIVIVAVISWAVATFGIQVFHYYERFAFLPQVIVVC
ILFGVSSVKFDLSTTSTGDPRTVAGNRLSFFSICLSAAVTYTPLAADFFVYYPENTSRAK
LFGLSLGGLLVSFTMALVSGVGLASGVSKHPEYSAAYEQGQGALIVEGFSPLHGFGKFCS
VICALGLIANTVAPTYSAGIDFQILGRYAEAVPRVIWNTIAVIIYTVCALVGRSNLSEIF
TNFLALMGYWVVIWIAIVLEERFIFRLRTGYNWHIWRDPSKLPIGIAAFTAFVVGWVGAV
LCMAQVWYIGPIAKLVGEYGADMGIYVGFCWTALVYPPLRFIELRFMPCPSIRVSHIAAF
GQGSARRLIRGFAYTTAFPRCIRLH
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggaaaatgaaatcaccgccctagcggtgcactccagcaaggaagacccggcg
acatttgcgcctgaatcccccggcgtggccaacaaggatgagggactctacgccgagacc
acgaccaatcgccgcaatcccgttggatcacgattgggctccgttattagagcttttgag
aatcagctcatcgagtataacctggaagcgcgtggtatcgagcgagttgctgcggatgag
cgcatgaagcgcaacacgtggatgtcgtatctgcaagtctccttgctttggatctctatc
aatcttgcacccaacaacattacccttgggatgctagggcctgccgtgtatggtctcagt
ttccgtgattcggcactttgtgctgtctttggcgccttcgttggttccttcgtcgcctct
tggatggccacatggggacccgtttccgggatccggacattggcctttggaaggtattcg
atgggctggtggcctagcaagatcattgttgtattgaacctaattcagatgattggatac
ggcttgatcgattgcgtcgttggcggacaaatcttgtctgctgtcagccctggtggcatg
tcggtagctgtcggcatcgtgatcgtcgcggttatcagttgggctgtggccacattcggc
atccaagttttccattactatgaacgattcgcctttttgccccaagtaatcgtagtctgc
atccttttcggagtgtcatcagtgaaatttgatttgtcgaccacctctaccggcgatccc
cggacagtagctggcaataggctatctttcttctccatctgtctgagtgccgcagtcacc
tacaccccactagcagcggacttctttgtctactaccccgaaaacacctcccgggcgaaa
ctattcggcctcagcctgggaggcctcctcgtctccttcacgatggccctagtcagcggt
gtcgggctagcctcaggagtctccaaacacccagagtactccgctgcttacgagcaaggc
caaggagccctaatcgtcgaaggattcagcccgctacacggcttcggcaaattctgctct
gtgatctgtgccctaggcctgatcgccaataccgtggcgcccacctactccgccggcatc
gacttccagatcctcggtcgttacgccgaggcagtaccgcgcgtcatctggaataccatt
gccgtcattatctataccgtctgcgcgctagttggccgcagcaacctctccgagatcttc
accaatttcctcgctttgatgggctactgggttgtcatctggattgctattgtcctcgag
gagcggttcatcttccgcctccgcactgggtataactggcacatctggcgggatccgtca
aagctgcccattggcattgccgctttcactgccttcgtcgttggctgggtgggtgctgta
ttgtgtatggcgcaggtgtggtacatcggacccattgctaaattggtcggtgaatacggt
gctgatatgggaatctacgttgggttctgctggactgcgcttgtttaccctcctctcaga
ttcatcgaacttcgtttcatgccatgtccaagcataagagtcagtcatattgctgctttt
ggacaaggctctgcacggcgtctcattagaggcttcgcttatactaccgcatttcctaga
tgcatacgcctgcattag

DBGET integrated database retrieval system