KEGG   Penicillium rubens: Pc20g11430Help
Entry
Pc20g11430        CDS       T01091                                 

Definition
(RefSeq) Pc20g11430
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pcs  Penicillium rubens
Pathway
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Pc20g11430
   00500 Starch and sucrose metabolism
    Pc20g11430
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Pc20g11430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 BNR
Motif
Other DBs
NCBI-GeneID: 8308953
NCBI-ProteinID: XP_002563629
UniProt: B6HG77
AA seq 643 aa AA seqDB search
MASKTAILGVLGLTVSTVWGQTLTEDMVEKMGNNSLFTRWRPYSHFLAPAGWMNDPCAPM
YDPVEGIYHMHYQFNPNHVNWGNISWGHATSSDLITWTDVDHNPGNALAGWQDGEAMSIG
TTNLTSDHHDPPMYNHLGIFSGTAQPVNISGEVDGTILAFYTSVSKLPTSYTLPYLHGTE
SQSLAYSTDGGVTWQEYADNPVISSPPDGWNVTGWRDPFYLLLPQLDTLLDKSEPHYYAI
LGSGIKGAGPRMPLYSAPASDLTNWTFLGALWEPAANSTLGSLEETGSYGLNFEVSNFFA
IGDRYFVSMGAEGGEVSFHDRRWSLWNEGEISTRPNGSIAFNPVSGGASDWGILYAITSF
DDTKNNRRIQYGWASEDMNNFGITQQGYQGALSLARELFIKETSGVVHNPADATPGNSRY
MSNSNGTWTASTLGVRPASDVVAGLRRGSRHTRSHCRKKMCSNTSNIRLPSTLSNSYELK
LNIKNTTGVTGVTVAASPGGEEYTNIYYDPSKKSVVLDRAHSSQIRVFPNTTLAGYFEPY
QMAGIHGGNPMTEPIEMNIFVDGSLVEVFVNDRFALTGRIYPSREDSNGFALYNAPGVSV
QYEDIQVWDGLLNVWPDRPLNSSSKLVFDTPAETNNYTWWEGN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaagacagcaattcttggtgtgctcggtctcaccgtctcaaccgtatggggt
caaaccctgacggaggacatggtcgagaaaatgggaaacaatagccttttcactcgttgg
agaccgtactcccatttcttggcgcctgcagggtggatgaatgacccttgtgccccgatg
tacgacccggtggaaggcatttatcatatgcactaccagtttaaccccaatcatgtcaac
tggggcaacatatcgtggggacacgcgacgtccagtgacctcataacttggactgatgtt
gaccacaaccccggcaatgcgcttgcaggatggcaagacggagaagcgatgtcaattggt
acgaccaacttgactagcgaccaccacgatccaccgatgtacaaccatctgggcatcttt
tccgggacagcccagcccgtcaatatctctggtgaagtcgatggaacgattctcgccttc
tacacgtccgtttcaaaactgccaacctcgtataccttaccctatctgcatgggaccgaa
agccaaagtctggcatactccaccgacggtggagtgacatggcaagaatatgccgacaac
ccagtcatcagcagcccacctgacggttggaacgtcaccggctggcgggaccccttctac
ctcctgcttccccagttggacacactactagacaagtccgagcctcactactatgccatc
cttggctccggtattaaaggcgctggccctcgcatgcccttgtacagtgctcccgcgtct
gatctcaccaattggactttccttggtgctctgtgggaacccgcagcgaacagcaccttg
ggctcgttggaggaaactggatcatatgggctcaactttgaagtttccaactttttcgct
attggtgaccgctacttcgtcagcatgggtgctgaaggaggcgaggtcagcttccacgac
cggagatggtctttgtggaatgagggggaaatttccacgcgtccgaatggtagcattgcc
ttcaaccctgtctcaggcggtgcgagcgactggggtattctatatgcgatcacctcgttc
gatgacactaagaataaccgccgtattcagtacggctgggcaagcgaggacatgaacaac
ttcggcatcacgcagcaaggctaccaaggggcgctgtccttggcgcgggaactcttcatc
aaagagaccagcggtgttgtccacaaccctgctgacgccacccctggcaactcccgctat
atgtcaaactccaatggcacatggactgcaagcaccctgggcgtgcgcccagccagcgat
gtagttgcgggtcttcgccgtggctctcgccacacccggtctcattgtagaaagaagatg
tgcagcaacaccagcaacatccgcctgcccagcactctcagtaattcctatgaattgaag
ctgaatatcaagaacaccacaggtgtcacaggtgtgacggtcgctgcctcgcccggtgga
gaggagtacacgaacatctactatgatccgtcgaagaagtccgtcgtcttggaccgcgcc
cactcctcccagatcagggtattccccaacacgacgctggctgggtactttgagccctac
cagatggcaggaattcatggcggtaatcctatgaccgaaccgatcgaaatgaacatattc
gtcgacggctccctcgtcgaggtctttgtcaatgaccgctttgctctcactggccgcatc
tatcccagcagggaggacagcaatggctttgctttgtacaatgcgcctggtgtcagcgtc
cagtacgaagacattcaggtctgggatggcttgctcaacgtctggcccgacagacccttg
aacagcagctccaagctcgtctttgacactcctgccgaaactaacaactacacttggtgg
gaggggaactaa

DBGET integrated database retrieval system