KEGG   Penicillium rubens: Pc20g12030
Entry
Pc20g12030        CDS       T01091                                 

Definition
(RefSeq) Pc20g12030
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pcs  Penicillium rubens
Pathway
pcs00100  Steroid biosynthesis
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Module
pcs_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Pc20g12030
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Pc20g12030
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8307252
NCBI-ProteinID: XP_002563689
UniProt: B6HDL5
AA seq 479 aa
MATKKVEYEFGGPLGAAGIIIGLPILLHVLFLACNDISGCPAPGLLSLRTLTWDTFILQI
PWPEDGIWGFGSWSVAAWVLTYYLVSLVLFRVLPAKEVLGTKLRESGKPLRYRFNAFLST
LVQLVPCAIGTYYYGSNFFLWVWIVDHYQQVLTANLALALLISLVVYARSFLVKPGNPQL
RELARGGQTGSIIYDFFIGRELNPRVHIPLIGTVDLKTWLAMRPGLTGWVLLNASFAAKQ
YRMYGYLSDSMVFLVAVQAYYVLEGQYAEEGIVGMMDFKTDGLGFMLTFGDIVWVPFLYS
TQCRYLATNPVHMGPYAFAAVGIIFAVGVYIFRASNAQKILFRENPDHPAFKNMPFIQTK
RGTRLLTGGWWGYARHINYFGDWLQSLPFCLPTGIAGYVVHPAGVATGVGAATMLDGRKV
VPGDAAGWGVLITYLYSVWFGVLLVHRERRDNRVCAEKYGEDWVEYKRVVRWRILPGVY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggctaccaaaaaggtcgaatatgagttcggcggccccctcggagccgctggcatcatc
atcggcctgccaatccttctccatgtcctctttctcgcttgcaatgatatcagcggatgt
cctgctcctggccttctgagcctccggacattgacctgggacactttcatccttcagatt
ccttggccagaagacgggatctggggttttggtagttggtcagttgcagcgtgggtgctg
acttactaccttgtgagccttgtgctgttccgtgtacttccagccaaagaggtgctgggc
accaaattacgagagtcggggaagccgctgcgatacaggtttaacgccttcttatccact
ctcgtccagctcgtgccctgcgctatcggcacgtactactacgggtcgaacttcttcctc
tgggtatggatcgtcgatcactaccagcaagtgcttaccgcaaacctcgcccttgctctg
ctgatatctcttgttgtctatgcccgtagcttcttggtgaagccaggtaacccgcaacta
cgcgaattggcacgcggcggccaaacggggagcattatctatgacttcttcatcgggaga
gagctcaacccgcgcgtgcacatccctctgatcggcacagtcgacctcaagacgtggctg
gcgatgcggcccggactgacgggttgggttttgttgaacgcatcctttgcagcgaagcag
taccgtatgtacgggtatctttcggatagtatggtgtttctggtggcggtgcaggcatac
tatgtcctggaggggcagtatgcggaggagggaatcgtgggaatgatggacttcaagacg
gatgggctgggatttatgttgacgtttggggatattgtgtgggtgccgttcttgtactcg
acgcagtgtcgatatctggcgacgaatccggtgcatatgggaccctatgcctttgcggct
gtgggaatcatcttcgctgtgggggtatacattttccgggctagtaatgcgcagaagatc
ctcttccgtgagaaccccgatcatccagctttcaagaacatgccgtttatccagacgaag
cgtggcacgcgacttctcacgggtggctggtggggttacgctcgccatatcaattacttt
ggcgactggttgcaatctttgccattctgtttacccacgggcatcgccggctacgttgtc
catcctgcgggggttgcaacgggagttggtgcggcaacgatgctggacggcaggaaagtg
gtgccaggggatgcggctggttggggagtcctgataacttatctttattcggtgtggttt
ggcgtactgctggtgcaccgagaacggagagataatagggtatgtgcggagaaatatggt
gaggactgggttgagtacaagagggtggtgaggtggaggatcttgccaggagtgtactag

DBGET integrated database retrieval system