KEGG   Penicillium rubens: Pc20g14260Help
Entry
Pc20g14260        CDS       T01091                                 

Definition
(RefSeq) Pc20g14260
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pcs  Penicillium rubens
Pathway
pcs00564  Glycerophospholipid metabolism
pcs00565  Ether lipid metabolism
pcs00590  Arachidonic acid metabolism
pcs00591  Linoleic acid metabolism
pcs00592  alpha-Linolenic acid metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pc20g14260
   00565 Ether lipid metabolism
    Pc20g14260
   00590 Arachidonic acid metabolism
    Pc20g14260
   00591 Linoleic acid metabolism
    Pc20g14260
   00592 alpha-Linolenic acid metabolism
    Pc20g14260
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Pc20g14260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 8315603
NCBI-ProteinID: XP_002563904
UniProt: B6HHB2
AA seq 793 aa AA seqDB search
MGAARVPRLWTVPPAALAAYTAGEWSQPRQSRASYSTSRTRYKDLESSKSNAGSDGLGEE
GKHDGSIWSNIGHKLDEVKQTVGSGEWADVGSIKGYIIPDWTRFLPATVQKLQRELSLSP
GSLADDIWKEARDPDINPEILRDAEVRVSGDLCDEEQEFRQQRQRKVVKALSSYLNIPEE
DIHPDDVPVIAMCGSGGGLRALVAGTGSYLAAQEAGLWDCITYTAGVSGSCWLQTLYHSS
IAQRDFDKLVDHLKNRLGAHIAFPPAALNLLTTAPTNKYLLGGFVEKLKGDPGADFGLVD
IYGLLLAARLLVPRGELGVSDADFKLSNQRANLINGAHPLPIYTAVRHEIPVEAVKHEDD
QTKKHPTPEQLAKESRNEAWFQWFEFTPYEFFCEELNAGIPTWALGRHFSAGRSEVSAEN
LPIPELRIPGLMGVWGSAFCATLSHYYKEIRPLVRGLAGFGGIDSLIQGKNQDLIKVHPI
DPAGIPNYVMGMKDQLPDSCPESIFRNEHLRLMDAGMSNNLPIYPLLRPGRDVDIIVAFD
ASADVKQENWLSVVDGYARQRGVKGWPVGAGWPKDASLKDTENALREPENISEEQLTEKL
ADAKNNTGNQPADQKPKSGTDLGYCNVWVGTTEERTSNDEPPPSKRLFDSPHSEDHSESE
FHLMRPDAGIAVIYFPLIPNSSAPDIPPKPRVHPRAAAQSMRQDSSQTKDPELPLAPHPN
SIDPAVDDFLSTWNFIYTPEQVDSVVGLAKANFSEGEEQTRRVVRAVYERKKSDRLQKEA
AELRKKMEGFVPL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgcaagggtgcctcgtctgtggacggtaccccccgctgccctagctgcatac
actgcgggggaatggtctcaacccagacaatcaagagcttcgtacagtacgtctcggaca
cggtacaaagatttggagtctagcaagtccaatgcgggctcagatgggcttggtgaggag
ggcaagcacgatgggtctatctggagcaacattggccacaagctcgatgaggttaagcaa
actgttggctccggcgagtgggcagatgtgggtagcatcaaaggctacattatcccggac
tggacacgatttctaccagctactgtccaaaagctccagcgcgagctctccctctcgcct
ggctcattggcagacgatatctggaaggaggcacgggaccccgatatcaaccctgagatt
ctgcgcgacgcggaggtacgcgtaagtggggatctatgcgatgaagagcaggaatttaga
cagcaaaggcaacgtaaggttgtaaaagcattgtcgtcctacctcaacatacccgaggaa
gacatccaccccgacgatgtaccggtcattgcgatgtgtggctcgggaggtggtctgcgt
gctctagttgcaggcaccggatcgtacttggcagcacaggaagcagggctgtgggactgt
attacctacacagctggtgtcagtggcagctgctggctgcagacgctttatcattcgtcc
attgcacagcgagacttcgacaagcttgtcgaccatttgaagaatcgtcttggtgctcac
attgcattcccgccggcagctcttaatctcctcactactgctccgacaaacaagtacctc
ctcggtgggtttgtggagaagttgaaaggtgaccctggtgcggactttgggttggtagat
atttacggattgctgctcgcagcgagactcttggtcccgcgaggagaattgggagtctcc
gatgcggatttcaagttgtcgaaccagcgagccaatttgataaatggggctcatccgctc
ccaatctacacggcggtgcggcatgagatccctgtcgaggctgttaaacacgaagacgac
cagaccaaaaagcatccaacacctgaacagctggcgaaagagtcacgaaatgaagcatgg
ttccaatggtttgagttcactccctacgaattcttttgtgaagaactcaatgccggcatt
cccacctgggctttgggacgtcacttcagtgcaggccgctccgaggtttccgctgagaac
ctccccatcccggagttgagaattcccgggctcatgggtgtttggggtagcgcattctgc
gcgactttgtctcactattacaaggagatccggcctcttgtcagaggcctggctggattt
ggtggaatcgattccctcatccaaggcaagaaccaagacttgatcaaggtgcatcccatc
gaccctgcgggtatacccaactacgtcatgggaatgaaagatcagctgcccgactcttgt
ccagagtcaattttccgaaacgagcacctgcgtctcatggatgcgggaatgagtaacaac
ctgccaatctacccgctccttcgacccgggcgcgatgttgatataattgtcgcgtttgat
gcgtctgcggatgtcaaacaggagaactggctttctgtggtagatgggtacgccaggcaa
cgtggtgtcaagggttggcccgtcggcgccggatggcctaaagatgcgagcctcaaggat
accgagaacgccctgcgcgagccagaaaacatcagtgaggagcaattaacagagaaactc
gccgacgccaagaataacactggaaaccagcccgctgatcaaaaacccaagtccggcacg
gacctaggctattgcaacgtttgggtcggcaccacggaagagcgaacgtcgaacgacgag
cctccgccatccaaacgtctctttgattctccccacagcgaagaccattctgaatccgag
ttccacctgatgcgacctgatgccggcatcgcggttatctacttccctctgattcccaat
tcttccgcaccagacatccctcccaaacctagagttcatccgcgtgcagctgctcagtcc
atgcgacaggatagctctcaaaccaaagacccggaactgccccttgccccacaccccaac
tcgatcgacccggcagttgatgatttcttgtctacttggaacttcatatatacgccagag
caggttgattccgtcgttggtcttgcaaaggcaaacttctccgagggtgaagagcagact
cgccgtgttgtacgtgctgtctatgaacgcaagaaatccgatcgtttgcagaaggaggca
gcagagcttcggaagaagatggaaggctttgtgcctctatga

DBGET integrated database retrieval system