KEGG   Penicillium rubens: Pc21g10420Help
Entry
Pc21g10420        CDS       T01091                                 

Definition
(RefSeq) Pc21g10420
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pcs  Penicillium rubens
Pathway
pcs03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Pc21g10420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcs03041]
    Pc21g10420
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Pc21g10420
Spliceosome [BR:pcs03041]
 Complex C
  Other components
   Step II factors
    Pc21g10420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD T2SSE AAA_22 AAA_30 AAA_19 ATPase AAA_29
Motif
Other DBs
NCBI-GeneID: 8309405
NCBI-ProteinID: XP_002568077
UniProt: B6HII9
Position
1
AA seq 1231 aa AA seqDB search
MDDLESLELFSLVSRVTNEFENHLGIADKTLAEFVIDQHLKCNGKFSDFKKFFDDMGGEF
PQSLLESVDRMVLTMHPKYKGKKAENANGASDANDDMDLLDALEQKSRVFKGLAVPDTEK
RWEEEDYIDRQAADEADAQAGAMDDTFAMLEGLAGKAKEDKPHAPRNDRGTRKRSRSPDS
NDYDRGRRRDKYRSRSRSRSAPRYSKNDDLVDEFGRSIGKYGNREDSRRNGHSDRRRRRD
RDEDDDFRRPPPVELDDHPVLFKIYDGTVTGVKDFGAFVNLKGVRGKVDGLVHVSAMQEG
ARVNHPSDLVSRGQPVKVKVASIDGTRIGLSMKEVDQVTGMDLVPQKRLASGANMERLDG
GLTDDRYGSLGSEVPVIEGSGGRPMRNRKRMTSPERWEIRQLIASGVASAADYPDIDDEY
NATLTGEGTFEEEEDIDIEVKDEEPPFLAGQTKQSLELSPIRVVKAPDGSMNRSAMAGTN
LAKERRELKQQEAQDKAAEKAADVDLNAQWQDPMVAPEERKFAADLRSAQQPKQDEAIPE
WKRATMGKNTSFGKRTNMSIKQQRESLPVYKFRKQLLDAVKDNQMMIVVGDTGSGKTTQL
TQYLAEGGYGNNGIIGCTQPRRVAAMSVAKRVAEEVGCKLGAEVGYTIRFEDCTSPDTKI
KYMTDGMLQREILLDPDLKRYSVIMLDEAHERTIATDILFGLLKKTVKRRPDLRLIITSA
TLDAEKFSEYFHGCPIFSIPGRTFPVEVMYSKEPESDYLDAALITVMQIHLTEPQGDILL
FLTGQEEIDTACEILFERMKALGPTVPELVILPVYSALPSEMQSRIFDPAPPGGRKVVIA
TNIAETSITIDQIYYVIDPGFVKQNAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGK
CFRLYTEAAYQSEMLPTTIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTAL
EELYALSALDDEGLLTRLGRKMADFPMEPALAKVLIASVDSGCSDEMLSIVAMLSIQSVF
YRPKEKQQQADQKKAKFHDPHGDHLTLLNVYNAWKHAGFNNSWCFENFIQARQIKRAKDV
RQQLLGIMNRYKHRIVSCGRDTIKVRQSLCTGFFRNAARKDPQEGYKTLVEGTPVYMHPS
SAMFGKPAEHVIYHTLVLTSKEYMHCTTAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERI
QPLHNRFAGEDDWRISAQRRQGRGGGGGTWG
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atggatgacctcgagtctttggagctgttctcgctcgtctcgcgcgtgacgaacgagttc
gagaaccacctgggaatcgccgacaagaccctcgcagagttcgtgatcgaccagcacctc
aaatgcaacggcaagttttccgatttcaagaaatttttcgacgacatgggcggcgaattc
ccgcagagtctcctggagagtgtcgatcgcatggtgctcacgatgcacccaaagtacaag
ggaaagaaagcggagaacgcgaacggcgcttctgatgccaacgacgacatggatttgctt
gacgctctggagcaaaagtctcgcgtgttcaagggccttgcagtacccgatacggagaaa
cgctgggaggaagaagactatatagatcgccaagcggcagacgaggccgatgcacaagca
ggcgcgatggacgacactttcgccatgctcgagggcctggcgggaaaagcaaaggaggac
aaaccacatgcaccgagaaacgatcgcgggacgaggaagcggagccgcagccctgattcc
aacgattacgaccgtggacggcgcagagacaaataccgctcgcgatcaaggtctcgaagc
gccccgcggtatagcaaaaatgatgatcttgtggacgagttcgggagatcgattggaaaa
tacggcaaccgggaagacagccgtcgcaatggacatagtgaccgccggagacgtcgtgat
cgcgacgaggatgatgatttccgtcgtcccccgcctgttgagctggatgaccatcctgtt
ctcttcaagatctatgatggaaccgtgaccggtgtgaaagactttggtgccttcgtgaat
ctaaagggcgtcaggggcaaggtggatggacttgttcacgtttcagcaatgcaagaggga
gcacgagtgaatcatccctcggatttggtctcgcgtggacaaccagtcaaagtcaaagtg
gctagtatcgatggcactcgcatcggactgtccatgaaggaggtggatcaagtgacaggc
atggatcttgttccccagaaacgccttgcttctggtgcaaatatggaacgtctcgatggc
ggactcacagatgacaggtacggcagtctcggctccgaggtgcccgtcattgaagggtcc
ggaggtcgaccaatgaggaaccgaaagcgcatgacttcgccggagcgatgggagatacga
cagttgattgcctccggtgttgcctctgcagcagattatcccgacatcgacgatgaatat
aatgcaacgctcaccggcgaaggcactttcgaggaggaggaagatatcgatatcgaggtc
aaagacgaggagcctcctttcctggctggccagacgaagcaatccctcgagctttctccc
attcgtgttgtcaaggctcccgatggttcaatgaaccgttctgcaatggcaggcactaac
cttgccaaggagagacgcgaattgaagcagcaggaagcacaagacaaggcagccgaaaag
gcggcggatgtcgatctcaatgctcagtggcaggaccccatggttgcacccgaagagcgc
aagtttgccgctgatcttcgaagtgctcagcagcctaagcaggacgaggctataccggag
tggaagagagcgacgatgggcaagaacacatcttttgggaagcggacgaacatgtccata
aaacaacaacgcgagagcctgccagtctacaagttccggaagcaattgttggatgcagtg
aaggacaatcaaatgatgattgtcgtcggagatacaggttctggaaagaccactcagttg
acgcagtacctggccgagggcggatatggaaacaacggaataattggttgcactcagcct
cgccgtgttgctgccatgtcggtggctaaacgtgtggccgaggaagttggttgcaagctc
ggagcagaggttggatataccatccgtttcgaggattgtactagcccagacaccaagatc
aagtacatgacggatggaatgcttcagagagaaattcttctggatccagacctcaagaga
tattctgtcatcatgctcgacgaagcgcacgagcggacaattgcgactgatattctgttc
ggattgttaaagaagacagtcaaaagaagacctgatctcagattgattatcacgtccgcc
acactggacgctgaaaagttctccgaatacttccacggttgtcccattttctccattccc
ggccgaactttccctgtcgaagtcatgtactccaaggagcccgaatctgattatctcgat
gccgcacttatcactgtcatgcaaattcacttgacagaaccccaaggtgatattctgctc
ttcttaacaggtcaagaggagattgatacggcatgtgagatcttattcgagcgcatgaaa
gctttagggcctactgtccctgagctggtcatcttgcctgtctattctgcactacctagt
gagatgcagagtagaattttcgatcccgcacctccaggcggacgtaaagtcgttattgca
accaacattgcggagacctcgattacaattgatcagatttactacgtcattgatcccggt
ttcgtgaagcagaacgcctacgatccaaagctgggcatggattctcttgtggtgaccccg
atttcccaagcgcaagcaaagcaaagagctggccgtgccggaagaacaggacctggaaag
tgtttccgattgtacacggaggctgcctatcagtctgaaatgcttccaacaacgattccc
gaaattcaacgtcagaacctctcacataccattcttatgctcaaggcaatgggtattaac
gaccttctccacttcgatttcatggacccaccccctaccaataccatgttgacagcactc
gaagaactatatgccttgtcagcactcgatgatgagggtcttttgactcgactcggacga
aagatggccgatttccccatggagcctgcgcttgccaaggtgctcattgcatctgtggat
tcgggctgctccgatgaaatgcttagcattgtcgccatgctgtcaatccagtctgtcttc
taccgccccaaagaaaagcagcaacaagcagaccagaagaaggccaaattccacgatccg
cacggcgatcatttgaccttgcttaatgtctacaacgcatggaagcacgcaggtttcaac
aactcctggtgtttcgagaacttcatccaagcacgacagatcaagcgcgccaaagatgtg
cgtcagcagctgctgggcatcatgaatcgctacaagcaccggattgtctcttgcggccgg
gataccatcaaagtgcgacagtccctgtgcaccggcttcttccgcaacgcagcgcgcaag
gacccccaggaaggatacaagaccctggtggaaggaacacctgtgtatatgcaccccagc
tccgcaatgtttggcaaaccggccgagcatgtcatctaccacacattggtactcacaagt
aaggagtacatgcactgtaccactgccattgagccgaaatggctcgtggaagcggcgcct
actttcttcaaggttgcacctacggatcgactgtcgaagcgtaagaaggcggagcgcatc
cagcctttgcacaaccgctttgctggtgaagacgattggcgtatctctgcccagcggcgg
cagggcagaggtggtggtggtggaacttggggttga

DBGET integrated database retrieval system