KEGG   Penicillium rubens: Pc21g15450Help
Entry
Pc21g15450        CDS       T01091                                 

Definition
(RefSeq) Pc21g15450
  KO
K17826  fumitremorgin C monooxygenase [EC:1.14.14.119]
Organism
pcs  Penicillium rubens
Pathway
pcs00404  Staurosporine biosynthesis
pcs01100  Metabolic pathways
pcs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Pc21g15450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pcs00199]
    Pc21g15450
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.119  fumitremorgin C monooxygenase
     Pc21g15450
Cytochrome P450 [BR:pcs00199]
 Cytochrome P450, fungi type
  CYP5067 family
   Pc21g15450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 8315546
NCBI-ProteinID: XP_002568555
UniProt: B6HJU3
Position
1
AA seq 503 aa AA seqDB search
MDVVARFMVSYSGTACAISLFIFGITLLFPFHKSQSFVCMNSHSWDIFRNKAKREFESNA
EKLIKDALRKGLTAFQLVTNMGTYLILADQYAEELRNDKRLSAYDALNDVILLELPGLET
MFQGSLHNHVSPTAIHAMNRELVHLTRALSDEANHRLQTQWTDSSEWHTVSIHDTVLALV
AQMTTRAFVGAELCRNAEWLDIAINFTINRAIAVQAVQAWPWILQPVVHWFLPTCKAVRR
QIQRARTILMPVLERERQTMHRKDSSSDRIFSTLTFIDQYAQGSRYDATMAQLRLTAVSV
LTTSDMVEKVLARICEHPELIQPLREEVVSVFESSGLHHKSLLKLTLMESVMKESQRLEP
ATLISMFRAAKKTVTLQDGTTIPKGTRLAFANDLRLDPELYPDPETFDGYRFERMRKDPE
QAKLAPFTKTRTSHLAFGHGKHACPGRFLSCDEAKLILCHILLKYDFKALDGRVPDLHVR
SMFIQRDTGGMLSVRRRQEEVTL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggttgccagattcatggtttcctactcagggacagcatgtgcaatttcactg
tttatctttggaattaccttgctgtttccatttcacaaaagccaatccttcgtctgcatg
aactcgcactcgtgggatattttcagaaacaaagcaaagcgagaattcgaatcaaatgca
gaaaagctcatcaaagatgcactacgaaaggggctcacggccttccaattggtaaccaac
atgggcacctatctgatccttgcagaccaatacgccgaagaactgagaaacgataaaagg
cttagcgcttatgatgccttgaatgatgtaatcttgctggagctgccgggccttgaaact
atgtttcagggctcgctgcataaccatgtgtcccctactgcaatccatgctatgaacagg
gagctagtccacttgactcgggcgctgtcggatgaagcaaaccaccgtctgcagactcag
tggacggacagttccgaatggcacactgtttcaatccacgacactgtcttggccttggtt
gctcagatgaccacgcgagcatttgtcggagcggagctgtgccgcaatgccgaatggctc
gatattgccattaactttacgataaaccgggctattgcagtccaggcagtccaggcttgg
ccatggatcctgcagcccgttgtccattggttcttgcccacctgcaaggctgtccgccgc
cagattcagcgagctcgaaccatcctgatgccagttctagaacgtgagaggcagactatg
cacagaaaagactcgtcatctgaccgaatattctcgacattaactttcattgatcagtat
gctcaagggtctcgctacgacgccaccatggcccagctgagactgaccgctgtatctgtc
ttgaccacatccgacatggtggagaaggtactggcaagaatttgcgagcatccagaacta
atccagccgctccgtgaggaagtagtgtcggtctttgaaagtagtggcttgcatcacaag
tccttactcaagctgacactcatggagagcgtgatgaaagaaagccagcggcttgaacct
gccacactgatctccatgttccgcgccgctaagaagacagtcacattgcaagatggtaca
actatccctaagggtacccgtcttgcctttgcaaacgaccttcgtctagaccctgagttg
tatccggatcccgaaacctttgacggttatcgatttgaaagaatgaggaaagatccagag
caggctaagcttgccccatttaccaaaacgaggacgagtcatttggccttcggccatggg
aaacatgcttgtcctgggaggttcctttcgtgcgatgaagctaagttgattctttgtcat
atcttgctcaagtacgacttcaaagcattagatgggcgtgtccctgatctgcatgttcgc
agcatgtttatccagagagatacaggagggatgctctcggtgaggagacgccaggaggaa
gttacactgtaa

DBGET integrated database retrieval system