KEGG   Penicillium rubens: Pc21g15460
Entry
Pc21g15460        CDS       T01091                                 

Definition
(RefSeq) Pc21g15460
  KO
K23890  mycotoxins biosynthesis FAD-dependent monooxygenase [EC:1.14.14.-]
Organism
pcs  Penicillium rubens
Pathway
pcs00404  Staurosporine biosynthesis
pcs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Pc21g15460
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     Pc21g15460
SSDB
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 Lycopene_cycl Pyr_redox_2 HI0933_like
Other DBs
NCBI-GeneID: 8315547
NCBI-ProteinID: XP_002568556
UniProt: B6HJU4
Position
1
AA seq 457 aa
MTVAHGVGPNGVAPPGSSGIQVIIVGLGIAGLVAAIECHYKGHVVVGLERSPGIRVLGSN
ATKVLQSWNNGEVLRHLVSQSDDVAAMEILDPAGKLYALDSMDGYGMGEGMIIHRGTLVH
GLYEHAKSLGIDLRFASAATDYWEDEGQAGVTVNGEQRIAAACVVGADGVHSKTRDYVLG
YQIAPQPSGLAAFRACFSANLLAGDPDAQWILEEAGVQDRMRRYITTGGLGLTLSTGKRG
QNVIWQVWHRKHEKADESWENVTDARVEDALALLQDWPTYPQVAAVLRHTPSEKLADYKI
ISRDPLPTWRSRGGRIMVIGDAAHAMSAIAGQGGGQSVEDAATLAICLELAGKSRVNLAL
HVVERIRYQRTSIIQDSGNAIYSQMRDPDWETIEKDPSMMKFPRPEWLFGYDVHRDVYEQ
FPYAMRAVQDNTGYRPRNIPSNSKYQVVHDYEKPVAA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgactgtagcacacggcgttggtcccaatggagtcgcgccacctggttcaagtggaatc
caagtgattattgtcgggcttgggattgctggtctggttgctgccatcgagtgccactac
aagggacatgtggtagtcggccttgagagaagtccgggcatcagagttctagggagcaac
gcgacaaaggtcctacagagttggaacaatggtgaagtgctgcgtcatcttgtctctcag
tccgacgatgtcgccgccatggagattctagaccccgcggggaagctgtatgccttggat
tccatggacgggtatggcatgggagagggcatgattatccatcgtggaacattggtccat
gggttatacgaacatgccaaatccctgggtattgatttgcgctttgcctcagctgccacc
gattactgggaggatgagggtcaagccggtgtgactgtcaatggtgagcaacggattgcg
gctgcctgtgtcgtgggcgcggacggcgtacatagcaagacccgagattatgtgctagga
tatcaaattgctcctcagccctctggactagctgcgtttcgtgcatgcttcagcgccaac
ttgctggcgggtgatcctgatgctcaatggattctggaggaagcaggtgtgcaggatcgg
atgcgaaggtacataacgaccgggggtctggggttgactttgtcaactggaaaacgcggc
cagaatgtgatttggcaggtctggcaccggaaacacgagaaggctgatgagtcctgggaa
aatgtcaccgatgcccgtgttgaggatgccctcgccttactccaggactggcctacgtac
cctcaagtggctgctgttctgcgacacacgcccagcgaaaagctcgcagactacaagatc
atctctcgtgatcctctgccgacatggcgttcccgtggtgggcgcatcatggtcataggc
gatgcagcccacgcgatgtcggcgattgcgggccagggaggtggtcagtctgttgaagat
gcggctacgttagccatttgtctggagctggcaggtaaaagccgggtgaatctggctctc
catgtggtggaaagaattcgataccagcggaccagcattatccaggacagtggtaatgcg
atttatagtcagatgcgagatccggactgggagacgattgagaaagatccgtcgatgatg
aagttcccacgtcctgagtggctcttcggctacgacgttcaccgtgatgtttacgagcag
tttccatatgcgatgagagctgttcaagataacacgggctatcggccacggaatattcca
tccaacagcaagtaccaggtggtgcacgattacgagaagccagtggcagcttga

DBGET integrated database retrieval system