KEGG   Penicillium rubens: Pc21g20310Help
Entry
Pc21g20310        CDS       T01091                                 

Definition
(RefSeq) Pc21g20310
  KO
K03505  DNA polymerase delta subunit 4
Organism
pcs  Penicillium rubens
Pathway
pcs00230  Purine metabolism
pcs00240  Pyrimidine metabolism
pcs01100  Metabolic pathways
pcs03030  DNA replication
pcs03410  Base excision repair
pcs03420  Nucleotide excision repair
pcs03430  Mismatch repair
pcs03440  Homologous recombination
Module
pcs_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pc21g20310
   00240 Pyrimidine metabolism
    Pc21g20310
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pc21g20310
   03410 Base excision repair
    Pc21g20310
   03420 Nucleotide excision repair
    Pc21g20310
   03430 Mismatch repair
    Pc21g20310
   03440 Homologous recombination
    Pc21g20310
DNA replication proteins [BR:pcs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    Pc21g20310
DNA repair and recombination proteins [BR:pcs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      Pc21g20310
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     Pc21g20310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 LolA_like
Motif
Other DBs
NCBI-GeneID: 8312120
NCBI-ProteinID: XP_002569021
UniProt: B6HKM6
Position
1
AA seq 185 aa AA seqDB search
MPRRAANKPGSQSTLSFGARGRVTKPVTAPSHKAKALDSTPALSDQSASATPEPQQLAVT
PNEPSKPHVADLAVRQQAAIEHQAPQSEEDKRALKLNKQDIWRYWQAQEQIRKAPRAHQQ
GMDVEEKILRHFDLSSQYGPCVGIARIKRWRRANQLKLNPPIEVLAVLLKGKNVKERAHI
DELLS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcgcgcagcaaataaacccgggtcacagtcgacactgtccttcggggcccgt
ggccgggtcactaaaccagtcaccgcaccatcccacaaagccaaggccctcgactcaact
ccagcgctctccgaccaatctgcctccgccaccccagagccccagcagctggccgttacc
ccgaacgagccctccaaaccccatgtcgcagacctagcggtgcggcagcaggccgcaatc
gaacaccaagcgcctcaatctgaagaggacaagcgggcactcaagttgaacaagcaggat
atctggcgatactggcaggctcaagagcagatccgcaaggcacctagggcccatcagcag
ggtatggacgtggaggagaagattctccggcattttgatctttcaagccaatacgggccc
tgcgttggaatcgctcgaatcaagcgctggagacgggccaatcagttgaagctcaaccca
cctatcgaggtccttgcggttcttctcaagggcaagaatgtaaaggagcgagcacatatc
gatgaattgctatcctga

DBGET integrated database retrieval system