KEGG   Penicillium rubens: Pc22g20800Help
Entry
Pc22g20800        CDS       T01091                                 

Definition
(RefSeq) Pc22g20800
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pcs  Penicillium rubens
Pathway
pcs00051  Fructose and mannose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pc22g20800
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Pc22g20800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 8305222
NCBI-ProteinID: XP_002565979
UniProt: B6HRL5
AA seq 388 aa AA seqDB search
MEKKAVHFGGGNIGRGFVAEFLHTAGYEVVFVDVMDSIITALQNTKSYEVTEVSDEGEAT
KTITNYRAINSKTHESDVINEISTATVVTCAVGPNILKFIAPAIAKGIDARTAATPLAVI
ACENAIGATDTLHHFIKDNTAQDRLGSMPDRARFANSAIDRIVPGQAADSGLNVRIEKFY
EWAVESTPFGEFGHPDIPAIHWVSDLEPYIERKLFTVNTGHATAAYYGYNAGKKTIAEAL
HDSRIRGIVRDVLQETASLIIDKHEISAAEQQEYVETIITRISNPYLEDTVERVGRAPMR
KVSRKERFIGPASQLAERGGKFQSLLGSLEMALRFQNVEGDEESVELAKILKENAPADAA
VRLTGLDRDHPLFPHVVKVVDGVQSDAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaagctgttcacttcggtggtggaaacatcggccgtggcttcgtggccgag
ttcctccacactgctggctatgaggtcgtcttcgttgatgtcatggacagtatcatcact
gccctacaaaacacaaagtcctacgaggtcactgaagtcagtgacgagggcgaggctacc
aagaccatcaccaactaccgtgccatcaactccaagacccatgagagcgatgtcatcaac
gaaatctcaaccgctaccgttgtcacctgcgctgtgggcccgaacatcctcaagttcatt
gcccctgcgattgccaagggcatcgatgcccgcaccgccgccacaccgttggccgtcatt
gcctgtgagaacgccatcggagccactgacactctacaccatttcatcaaagacaacacc
gctcaagaccgtctcggctctatgccagaccgagcccgctttgctaactcggccatcgac
cgtattgtgcctggccaggccgccgacagcggtctcaacgtgcgcatcgagaagttctat
gaatgggctgtggagtcgacgcctttcggcgagtttggtcacccagatatcccggctatc
cactgggttagcgacctggagccctacattgagcgcaagttgttcactgtcaacaccggt
cacgccactgcagcctactatggctacaatgccggcaagaagaccattgccgaagctctc
cacgactctcgcatccgcggcattgtccgtgatgtgcttcaagagactgcctccctcatc
atcgacaaacatgaaatcagcgccgctgagcagcaagagtatgtcgagaccattatcacc
cgaatctctaacccctacctcgaagacaccgtggagcgcgtgggtcgcgccccaatgcgc
aaagtgtcccgcaaagagcgtttcatcggcccggcttcgcagctggccgagcgtggcgga
aagttccagtcattgctgggctccttggaaatggctctgcggttccagaatgtggaaggt
gacgaggagagtgtggagctggccaagatcctcaaggagaacgcgcctgctgatgctgct
gtccgattgaccggcttggaccgagaccaccccctcttcccccatgtggtcaaggtcgtg
gacggcgtgcaatctgacgcaaagtag

DBGET integrated database retrieval system