KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0053
Entry
PC1_0053          CDS       T00934                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pct00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PC1_0053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pct02044]
    PC1_0053
Secretion system [BR:pct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PC1_0053
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Phage_Mu_Gp45 Gp5_C
Other DBs
NCBI-ProteinID: ACT11115
UniProt: C6DGM8
Position
complement(61325..63178)
AA seq 617 aa
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASPLPGIDFGAVLDQPCE
LLVWYEGELQRRVSGIVSAFAQGDTGFRRTRYQAEVRPTLWRLGLRTNARIFQAQKPEAI
IGALLEEAGITDYAFALRNEHAVREYCVQYRESDLAFIARLAAEEGLFFFHEFEEGKHRV
VFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVALKDYSFKTPAYGLLH
QKISGELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALRAGAMTGSGESNAAELMPGS
SFTLTEHPNLALNIGWQLVAITHSGQQPQALEEESGGEPTTYSNSFEVVKASTTWRADLP
YKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTTLRTTTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTSVNVDHNENIGRDQTVVVQQNQTVSVIA
DQVTEIQGEQTVVVKKNRSTVVEDNETLRVTNNIFIHAEDGSIQIGTGAGYISIKHSGDI
EIVGNNLTLNGTRIDLN
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggcaaacagtacaggattacagttcaccgttaaggtcggcgcattgcctgcgtcgacc
tttgccgtggtggattttcagctcagcgaggcgctcaaccagccgtttgccctgtcgctg
aatctggccagccccttaccggggatcgattttggtgcggttctcgaccagccctgcgaa
ctcctggtgtggtacgaaggtgaactccaaagacgagtgagcggtattgtcagcgcgttt
gcgcagggcgataccggctttcgccgcacacgctatcaggcagaagtccgtccgactctg
tggcgtttggggctacgtaccaatgctcgtatatttcaggcgcagaagcctgaggcaatt
atcggcgccctgctggaagaagcgggcatcaccgactacgcctttgcgctgcgcaacgag
cacgcagtgcgggaatattgcgtgcagtaccgcgaaagcgatttggcctttattgcccga
ctggctgccgaagaaggcctgttcttcttccatgagtttgaggaaggcaaacaccgcgtc
gtctttgccgacgatgcaggcgcgttggcaaaaggccctgagctgtttttcaacctggcg
acacaggggctgagtgaaggcgcatacgtgcgtcgtttccgctatgccgaggcggtgagc
acagcagaagtcgcactcaaagactacagcttcaaaaccccagcctatggcctgttgcac
cagaaaatcagcggagaactggaacaccagcgcgaaagttaccaacacttcgactacccc
ggtcgttttaaacaagatccgagcggtaaagcctttaccggctatcggctggatgcactg
cgagcaggggcgatgaccggctcgggcgaatcgaatgccgctgaactgatgccgggcagc
agtttcaccttaaccgaacaccccaatctggcactcaatatcggctggcagttggtcgcc
atcacccacagcgggcagcagccgcaggcgctggaagaggaaagcggcggcgaaccgacc
acctacagcaacagctttgaagttgtgaaagctagcacgacctggcgcgccgacctgccc
tacaaaccaatggtagacggcccgcagatcgccaccgtcgtcggcccggcgggtgaagaa
atttactgcgaccagtacggcagggtgaaactgcaattcccgtgggaccgctacggcgca
agcgatgaccagagctcctgctgggtacgcgtcagccagggttgggcaggcggccaatat
ggcctgatcgctatcccgcgcatcggccatgaggtcatcgtcagcttcctcgaaggcgac
ccggatcagcccatcgtgacgggcagaaccttccacgccaccaatccctcaccctacccg
ctacccgccaacaaaacgcgcacgacactgcgcaccacgacccataaaggcgccgggttc
aacgaactgcgctttgaggatcaggctggtcaggaagaagtgtttatccatgcccagaag
gacatgaacaccgtggtgctgaataaccgcagtacatcggtgaatgtggatcacaacgaa
aacattggccgcgatcagactgtcgtcgtgcagcaaaaccagacggtttctgttattgcc
gatcaggttaccgagatccaaggggagcagacggtggtggtgaagaaaaaccgaagcacc
gtcgtggaagacaatgaaacgctgagagtgacaaacaacatctttatccacgccgaagat
ggcagcattcagattggtacgggtgcgggctatatctcaatcaagcacagcggggatatt
gagatcgtcgggaataacctgacgctgaacggcacccgtatcgatttgaattaa

DBGET integrated database retrieval system