KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0212Help
Entry
PC1_0212          CDS       T00934                                 

Definition
(GenBank) thiazole biosynthesis family protein
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00730  Thiamine metabolism
pct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PC1_0212
Enzymes [BR:pct01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     PC1_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiG His_biosynth NanE FMN_dh IMPDH
Motif
Other DBs
NCBI-ProteinID: ACT11272
UniProt: C6DHS2
Position
complement(252933..253718)
Genome map
AA seq 261 aa AA seqDB search
MLHIADTTLTSRLLTGTGKFATPELMLAALEASGSQLVTMAMKRVDLNGGNDAILAPLRQ
LGIKLLPNTSGAKTADEAIFAARLAREALGTHWLKLEIHPDVKYLLPDPIETLKAAEQLV
KEGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLQTRDFLRIIIEQARVPVIV
DAGIGAPSQAADALEMGADAVLVNTAIAVARDPVAMARAFRLAVEAGGLARQAGLGSKQF
VASATSPLTGFLHQQAEGAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacattgccgatacgacattaacttcacggctgctgactggcaccggaaaattc
gccacgccagaactgatgctggcggcactcgaggcttccggttcgcagttggttacgatg
gcgatgaaacgcgttgacctgaacggcggcaatgacgccattctcgccccgctacgccag
ctcggcattaagctgctgccgaatacgtcaggagccaaaaccgctgacgaggccattttt
gcagcgcgtctggcacgtgaggcgttggggactcactggctgaagctggaaattcatccc
gatgtgaaatacctgctgcccgaccctattgaaactctgaaggccgctgaacagctggta
aaagaaggattcacggtactgccttactgcggggccgacccggtactatgcaaacggctg
gaagaagtcggctgcgcggcggtgatgcctctcggtgcaccgattggctccaatcagggg
ctacaaacgcgtgattttctccgcatcatcatcgaacaggcacgcgttccggtgattgtc
gatgcaggcattggcgcccccagccaagcggccgatgcgctggaaatgggagcagatgcc
gtgctggtcaacacggccatcgccgttgctcgcgatcccgtcgcgatggcgcgcgccttc
cggctggcagtcgaggcaggtggccttgctcgtcaggccggtctgggaagtaagcagttt
gtcgccagcgccaccagcccgctcaccggttttctgcatcagcaagcggaaggagcggta
agatga

DBGET integrated database retrieval system