KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0448Help
Entry
PC1_0448          CDS       T00934                                 

Definition
(GenBank) transcriptional regulator, XRE family
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00760  Nicotinate and nicotinamide metabolism
pct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PC1_0448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pct03000]
    PC1_0448
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     PC1_0448
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     PC1_0448
Transcription factors [BR:pct03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    PC1_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 CTP_transf_like Citrate_ly_lig ABC_tran MMR_HSR1 HTH_37 AAA_29 HTH_35 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ACT11504
UniProt: C6DJU1
Position
complement(510619..511872)
Genome map
AA seq 417 aa AA seqDB search
MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPSAQKLEALHRFLELEFP
RYEKSIGVVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDEPRDRLLFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKGIQAFMQEKSITPNFVYTSEE
QDAPQYREHLGIEAVLIDPQRSFMNISGSQIRHDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
STTARSEFQNLLKTMLADNNIQYVYIKESDYDSRFLHCVELVQQMLGHDRSPEQSKS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatttgattacctgaaatccgccatccggcagaagggttgcaccctacagcag
gttgccgacgcgaccgatatgaccaaaggctatctcagtcaattacttaatgccaaaatc
aaaagccctagcgcgcagaagctggaagcgctacatcgctttcttgaactggaattccca
cgctacgaaaagagtattggcgtcgtcttcggcaagttctatccgctacacaccggccac
atttatctgattcagcgcgcctgcagccaggtcgatgaactgcatgtgattttaggttac
gacgaaccgcgtgaccgactgctgtttgaaaacagctcgatgtcgcaacagcctaccgtc
agtgaccgtctgcgctggctattacagacctttaagtatcagaaaaacattcatattcat
gcttttaatgagcaagggatggagccttacccgcacggctgggatgtgtggagtaaaggg
attcaggcgttcatgcaggaaaaaagcattacgcccaatttcgtctacaccagcgaagaa
caggatgccccacaataccgtgagcatttgggtattgaggcggttctgatcgacccacag
cgctccttcatgaacatcagcggttcacagattcgtcacgatcctttccgttactgggac
tatatcccgaccgaggtgaagccattctttgtgcgtaccgtggctattcttggcggcgaa
tccagcggtaaatccacgctggtgaataaattggccaatatcttcaataccaccagtgcc
tgggaatatggccgcgattacgtgttctctcatctgggcggcgacgagatggcgctgcaa
tattccgactacgacaagatcgcgctgggtcaggcacagtacattgattttgcagtcaaa
tacgccaataaagtggccttcatcgacaccgatttcgtcaccacccaggcattctgcaaa
aaatatgaaggtcgtgaacacccgttcgttcaggcgctgatcgacgaataccgtttcgat
ctggtgattttgctggaaaataacacgccgtgggtggccgacgggttacgcagtttaggc
agtactaccgcccgctcggagttccagaacctgctgaaaacgatgctggctgacaataat
atccagtacgtttacatcaaagagtcagactacgattcgcgcttcctgcactgtgtagaa
ctggtacagcagatgctgggccacgatcgctcgcccgaacagagcaaaagctag

DBGET integrated database retrieval system