KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0914Help
Entry
PC1_0914          CDS       T00934                                 

Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pct00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PC1_0914
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pct03400]
    PC1_0914
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PC1_0914
DNA repair and recombination proteins [BR:pct03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PC1_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 ResIII AAA_11 HAD_SAK_2
Motif
Other DBs
NCBI-ProteinID: ACT11964
UniProt: C6DAF6
Position
1057054..1060638
Genome map
AA seq 1194 aa AA seqDB search
MNSAAPQSLDVMTLPLLGERLIEASAGTGKTYTLAALYLRLLLGLGKQAAYPRPLLVEEI
LVVTFTEAATEELRERIRARIHALRIACLRKSAQGEESEKPKDASLTQLLAEISDHRDAA
DVLLAAERQMDEAAIYTIHGFCQRMLSTNAFESGVLFEQVLIEDEQPLRRQACADFWRRY
CYPLPVEVARIVGLEWKGPENLLADLAPYLHGEAPAFRLMPEEDETLQSRHDKIVATIDA
YKQRWLASAADLEALISASGVDKRSYSSKHLPNWLQKVTLWAEQQPTLDYQLPKDLVRFS
QQALIEKTKKGEPPVHALFEETDRLLATPLSLRDLVIVRALSAIRESVSEEKRQRAELGF
DDLLSRLDVALQQPGGERLASAIRERYPVAMIDEFQDTDPQQYRIFRTLYVGQPQCGLLL
IGDPKQAIYAFRGADIFTYMHARGEVAAHYTLGTNWRSSHQMVHGVNRLFERLEYPFIFQ
NIPFLPVKPAESKRGLVFEVAGKPQPALQFWLTGSEPIGIGDYQQRMARQCAAQIRDWLA
ASQRNEAWLVTDDSQRLVKASDMSVLVRSRREASLIRDALSRLSIPSVYLSNRDSVFSTP
EASDMLWLLQAVLAPEQERTLRSAMATALMGLDAGQVDALGQSETAWDALVDEFAGYRAL
WRQKGILPMLRALMSRHQLAENLLASAEGERRLTDILHIGELLQDASATLDSEHALVRWL
SQQIVQPNPQAENQQLRLESDRHLVQIVTIHKSKGLEYPLVWLPFISHFRVQDQGIYHDR
ESYQAVLDLQNHEESQTLAEEERLAEDLRLLYVALTRSIYHCSVGVAPIQRSRKKDGSSD
MHQSALGYLLQRGKEAEAATLVSELEGMVGDGVALTPLQATEEQRWQPDRPELAELRARH
IERQLRDGWRVTSYSGLQQHGSAGAQDLVPRLDIEAIGERQEGDETQLTPHTFPRGASPG
TFLHSLFETLDFTQPVDDGWLAEQLQLQGFEAHWQPVLKAWMNTLLQTPLNEQGITLSAL
DNADKQAELQFYIPIEAPIQAAQLDRLAKHHDPLSARCPALSFQQVKGMLKGFIDLVFRW
EGRYYLLDYKSNWLGPDASAYTQTAMMQSMAEHRYDLQYQLYTLALHRYLRHRIADYDYE
RHFGGVFYLFLRGVEESHPGNGIFACRPSAEFVFGLDTLFKGKTPDDADTGIPS
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcgccgcgccgcaatcattagacgtcatgacgttgccgctcctgggggagcgg
ctgattgaggcgtcggccggaacagggaaaacctatacgctggcggcgctctacctgcgc
ctgctactggggctgggtaagcaagccgcttacccacgtccgctgctggtcgaggaaatt
ctggttgtgacctttacggaggcggcgaccgaagaactgcgggaacgtattcgagccaga
atccacgccttacgcatcgcctgcctgcgtaaaagtgcgcagggtgaagagtcggagaag
cctaaagatgcttcgctaacacaactgctggcggagatttctgaccatcgcgatgcggcc
gatgtcttgctggctgccgaacgacaaatggacgaggcggcgatctacacgatccacggt
ttctgccagcgtatgctcagtaccaatgcgtttgagtctggtgtgctttttgaacaggtg
ctgatagaagatgagcagccgctgcgccgtcaggcctgcgccgacttttggcgtcgttat
tgctatccgttgccggtagaggtcgcacgtattgtcggtctggagtggaaagggccggaa
aacctgctggccgatctggctccctatctgcacggtgaagcgcctgcatttcgcttgatg
ccagaagaggacgaaacgctgcagagtcggcacgataagatcgtggcgacgatcgacgcg
tataaacaacgctggctggcgtcagcagcggatctggaagcgttgattagtgcttctggt
gtcgataaacgcagctacagcagtaagcatctacccaactggctacagaaagttacgctg
tgggcagagcagcagccgacgctggattaccaactgccgaaggatctggtacggttttcc
cagcaagcgctcattgaaaagacgaagaaaggggaaccgcccgttcatgccctctttgag
gaaacagaccggctacttgccacaccgctgtcgctgcgtgatttagtgattgtgcgtgca
ctgtcggcaatccgggagtcagtgagtgaggaaaagcggcagcgtgcagagctagggttt
gacgatctgctgagccgtctggatgttgcgttgcaacagccgggtggggaacggcttgcc
agcgccattcgcgaacgctatccggtggcgatgatcgatgaatttcaggataccgacccc
cagcaataccgtatttttcggacgctgtatgttgggcagccgcagtgtgggctgctgttg
atcggtgaccctaagcaggctatttatgcgtttcgcggtgcggatatttttacctatatg
cacgcgcgcggagaagtggctgcacattatacgctgggcacgaactggcgatcgtcacac
cagatggtacatggcgttaatcgtctatttgaacgcctcgaatatccttttatttttcaa
aacatcccgttcctaccggtcaagcctgccgaatctaagcgcggtttggtgtttgaggtt
gccgggaagccgcagcctgcactgcaattctggctaaccggttcagaaccgattggcata
ggggattaccagcagcggatggcgcgccagtgtgcggcgcagattcgtgactggctcgcc
gccagccagcgtaatgaagcctggttggttaccgatgattcccagcgtttggtcaaggca
tccgacatgagcgtgctggtgcgtagccgacgtgaagcctcgctgattcgtgatgcgctg
agccgtttgtctataccttcggtgtatctgtccaatcgcgacagcgtattcagtacgccg
gaagccagcgatatgttgtggttgttgcaggcggtgctggctccagagcaggagcgcacg
ttacgcagcgcgatggcgacggctctgatggggttggatgctgggcaggttgatgcatta
gggcaaagtgaaaccgcgtgggatgcgctggtagatgagtttgcgggttatcgcgcgttg
tggcgtcagaaaggcatactgcccatgctgcgcgcactgatgagtcgccatcaattggcg
gagaacctgctggcgagcgcggaaggggaacgccgtctcaccgatattctgcatatcggt
gagttgttgcaggatgcctcggcaacgctcgacagtgaacacgcgctggtgcgctggcta
tcgcaacagattgttcagccgaatccgcaggcagagaaccagcaactgcgtctggaaagc
gatcgccatctggtgcagatcgtgacgatccataaatcgaaagggctagaatatccgctg
gtgtggctgcctttcattagccacttccgcgtgcaggatcaggggatttatcacgatcgc
gagagctatcaggccgtgttggatctgcaaaatcatgaagaaagccagacgctggcggaa
gaagagcggctggcggaagatttacgtttgttatatgtcgcgctgacccgttctatttat
cactgtagcgtcggcgtcgcaccgattcagcggtcacgtaagaaagacggcagcagcgat
atgcaccagagcgcgctgggttatttactccagcgtggtaaagaagctgaggctgccacg
ttggttagcgagctggaaggcatggtcggtgacggtgtcgcattaacaccgttacaggca
acggaagaacagcgctggcagccggatagaccagaattggcggagctacgggctcgccac
attgaacgtcagctacgcgacggctggcgagtcaccagctattcagggcttcagcaacat
ggttccgcaggcgcgcaggatctggttccgcgtctggatattgaggcgataggcgagcgt
caggaaggggatgaaactcaactgacgccgcatacgttcccgcgcggcgcgagtccgggg
acgtttttacatagcctgtttgaaacgctggatttcactcaacccgttgatgatggctgg
ttggccgagcagttgcagctacagggatttgaagcccactggcaaccagtgttgaaggcg
tggatgaatacgcttttgcagacgccgcttaacgaacaggggattacgctatcggcgctg
gataatgcagataagcaggctgaattgcagttctatatcccgatcgaggcaccgatacag
gcggcgcagttggatcggctggcaaagcatcacgatccgctatctgctcgctgtccggca
ctctcttttcagcaggtgaaaggtatgctgaaagggtttatcgatctggtgttccgctgg
gaagggcgctattacctgctggactacaaatccaattggcttggccctgatgccagtgcg
tacacccagacagccatgatgcagtcgatggccgaacatcgctatgacctgcaatatcag
ctctacacgctggccttgcatcgctatctccgtcaccgcattgcggattacgactatgag
cgccattttggcggcgtgttttatctgtttttacgcggcgttgaggaatctcaccccggc
aatggcatctttgcttgtcgtccctccgctgaatttgttttcgggcttgatacgctcttc
aagggaaaaacgcctgacgatgctgatacaggaattccctcatga

DBGET integrated database retrieval system