KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0935Help
Entry
PC1_0935          CDS       T00934                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
KEGG Orthology (KO) [BR:pct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pct03016]
    PC1_0935
Enzymes [BR:pct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     PC1_0935
Transfer RNA biogenesis [BR:pct03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    PC1_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACT11985
UniProt: C6DAH7
Position
1083565..1084365
Genome map
AA seq 266 aa AA seqDB search
MAQYTMLEIIYQDEHLVAVNKPSGWLVHRSWLDRKEKVVVMQTVRDQIGQHVYTVHRLDR
PTSGVLLLALSSEVARALSQQFESHQMQKMYHAVVRGYVLDDGVIDYALTEELDKIADKF
TNPDKAPQPAVTHYRSLAQVEMPVAIGRYPTARYSLMELKPQTGRKHQLRRHMSHLRHPI
IGDTAHGDLRHNRGMETHFSCGRLMLHASELQLNHPVSGQPLTLQARWDAPWQGVMTQFG
WQGILPDFEGVEFPADSGQDSEHFIG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtacacgatgcttgagatcatttatcaggatgagcatctggtcgccgtcaat
aaacccagcggctggttagtccaccgtagctggctggatcgcaaagaaaaggtcgtggtg
atgcagaccgtgcgcgatcagatcggccaacacgtgtataccgtccatcgtctcgacagg
ccgacatccggcgtgttgctgctcgcgctgtccagcgaggtggcccgtgcgttatcccag
cagtttgaatcacaccagatgcagaaaatgtatcatgctgttgtgcggggctatgtactg
gatgacggcgtgatcgactatgcgctcaccgaagagctggacaagatcgccgacaagttc
actaatcctgataaggcaccgcagcctgccgtcacgcattatcgttctttggcgcaggtc
gaaatgccggttgccatcggccgttacccaacggcacgctacagtctgatggaactgaag
ccgcagaccgggcgtaagcatcagcttcgtcgccatatgtcacaccttcgtcatcccatt
atcggcgataccgcgcacggtgatctgcgacacaaccgtggcatggagacacatttctcc
tgcggcaggcttatgctgcatgccagcgagctgcagctgaatcatccagtgagcggacag
ccattgacgttgcaagctcgctgggatgcgccgtggcagggcgtgatgactcagtttggc
tggcagggcattctccctgattttgaaggggttgagtttcccgccgactcgggtcaggat
agcgagcatttcatcgggtaa

DBGET integrated database retrieval system