KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1160Help
Entry
PC1_1160          CDS       T00934                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00071  Fatty acid degradation
pct00280  Valine, leucine and isoleucine degradation
pct00310  Lysine degradation
pct00362  Benzoate degradation
pct00380  Tryptophan metabolism
pct00620  Pyruvate metabolism
pct00630  Glyoxylate and dicarboxylate metabolism
pct00640  Propanoate metabolism
pct00650  Butanoate metabolism
pct00900  Terpenoid backbone biosynthesis
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01212  Fatty acid metabolism
pct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PC1_1160
   00630 Glyoxylate and dicarboxylate metabolism
    PC1_1160
   00640 Propanoate metabolism
    PC1_1160
   00650 Butanoate metabolism
    PC1_1160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PC1_1160
   00072 Synthesis and degradation of ketone bodies
    PC1_1160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PC1_1160
   00310 Lysine degradation
    PC1_1160
   00380 Tryptophan metabolism
    PC1_1160
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PC1_1160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PC1_1160
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PC1_1160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pct04147]
    PC1_1160
Enzymes [BR:pct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PC1_1160
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PC1_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACT12208
UniProt: C6DBU1
Position
complement(1359577..1360755)
Genome map
AA seq 392 aa AA seqDB search
MNDSVVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASQAAGLSFETPSLTVSKVCGSGLKAVVLGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGNGKLVDIMINDGLWCAFNDYHMGTTAENIAERYQLTREEQDRVAL
ASQQKAVAAIEAGRFKAEITPLSLRNKKETRIFDRDEFPRADTTLSSLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccgttgttattgttaatgccaagcgcaccgcaatcggtaaattcgcaggc
agtctggccaacacatccgctatcgagatggcgtcagccaccattcgtgactgtctgtcg
acgctgccggacacgctggcgatcgatgaagtgattctcggtaatgtgctgcaagccggt
ctgggtcaaaacccggcacatcaggcaagtcaggctgccggtctctcttttgagaccccc
tcgctgaccgtcagcaaagtctgtggctccggcctgaaggccgtcgtgctcggcgcacag
tctattctgtccggcgataatcaggtctgcgtaacgggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatggggaatggcaagctcgtt
gatatcatgattaacgatggcctgtggtgtgcgtttaacgattaccacatgggcaccaca
gcggaaaacatcgccgagcgctaccagcttacgcgtgaagaacaagatcgggtggcgctg
gcgtcccagcagaaagccgtcgccgcgattgaggctggccgcttcaaggcggaaattact
ccactgtcactgcgtaacaagaaagagacgcggatcttcgatcgggacgaattccctcgt
gcggataccacgctatcgtcgctggcagcgctacgtccggcattctccgcgaacggcacc
gtcaccgcaggcaatgcgtccggcattaacgatgcggccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacaggggattaccccgctggcgcgcatccgcagttgggcatct
gccggtgtaccgagtgaggtcatgggactgggaccaattcccgcgacgcagaaagcgcta
ctcaaagccgggctgacaatcggcgatatcgacctgattgaagccaacgaagcctttgcc
gcgcagtttctagctgtacagcgcgatctccagctcgatccagaaaaagtgaacgtcaac
ggcggcgcgattgcgctgggtcaccctatcggggcaagcggcgcgcgcattcttgtcacg
ttggtacacgcgctgcacagctacaacaaaacgctggggctggcgacgctgtgcatcggc
ggtgggcaaggtatcgcgatgatcgttgagcgcatttaa

DBGET integrated database retrieval system