KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1233Help
Entry
PC1_1233          CDS       T00934                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00020  Citrate cycle (TCA cycle)
pct00190  Oxidative phosphorylation
pct00650  Butanoate metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
Module
pct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pct_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PC1_1233
   00650 Butanoate metabolism
    PC1_1233
  Energy metabolism
   00190 Oxidative phosphorylation
    PC1_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF2070
Motif
Other DBs
NCBI-ProteinID: ACT12281
UniProt: C6DCD1
Position
1439481..1439828
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYEIWRGFFSMALTKVF
TLLTLFSILVHAWIGMWQVLTDYIKPLALRLTLQLAIVVALLVYVIYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttaggacgcaatggcgtacacgattggttactgattcgc
gcttccgccatcgtcattgttctgtatgtaatttatatcattggttttattgctacggct
ggcgatatcacgtatgaaatctggcgtggtttcttctcgatggctctcaccaaagtattc
acactgctaacgttattttccattctggttcatgcctggatagggatgtggcaagtgctg
accgactacattaaaccgctggccttacgcctgactttacagttggcgattgtcgtagcg
ctgttggtgtacgtcatttatggaactattgtggtgtggggtgcgtga

DBGET integrated database retrieval system