KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2276Help
Entry
PC1_2276          CDS       T00934                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pct00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PC1_2276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pct01001]
    PC1_2276
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pct02022]
    PC1_2276
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PC1_2276
Protein kinases [BR:pct01001]
 Histidine kinases
  OmpR family
   PC1_2276
Two-component system [BR:pct02022]
 OmpR family
  RstB-RstA
   PC1_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACT13314
UniProt: C6DJ44
Position
2616406..2617719
Genome map
AA seq 437 aa AA seqDB search
MRKLFVQFFLLLFACFVVMTLLVGLVYKVTAERAGRQSMDDLMKSSLYLIRNELRAIPPR
DWHKTINQLDLNLSFKLHIEPVSKYALSPKNRQRLNQGEIIALDDEYTFIQRIPRSHYVL
AVGPIPYLFFLHEMRLLDLLLVMLIGLSLALPVFLWMRPHWQAMLKLENAAQRLGDGHLE
ERIHFDSTSSLFRLGVAFNRMADNLNQLINSKKQLIDNIAHELRTPLVRLRYRLAMSDNL
TEDEQQALNRDIGQLEALIDELLTYARLDRPQVTLHLANIDIPSWLQAKVDDFRLIHPDK
HISLDMPHSAQIGALDLRLMERVLNNLIGNGLRFCHSRLHISLTSDAEHIACLQVEDDGP
GIAPESRESVFEPFIRLEAGIENSSGGCGLGLAIVNAIARAYEGSITVDESPLGGARFRF
CWPVKTTTAQTTIAIQH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagctgttcgtccagttttttctattgctgttcgcctgttttgtcgtcatgacg
ttactggtcgggctggtttataaagttacggccgaacgtgccgggcgtcagtccatggat
gacctgatgaaaagctcgctgtacctcattcgtaatgagctgcgcgcgatcccgcctcgc
gactggcataaaaccatcaaccagcttgatttaaacctgtcgttcaaactgcacatcgaa
cctgtgagcaaatatgcactgagtcccaagaatcgccagcgtctgaatcagggggaaatt
attgcactggatgacgaatatacgtttatccaacgcatcccacgcagccactacgtgctc
gctgtcggccctattccttacctgttcttcctgcacgaaatgcggctgctggatttactg
ctggtgatgctgattgggctgtcgctggcgctgccggttttcctctggatgcggccacat
tggcaagcgatgctaaaactggagaatgctgcacagcgtctgggcgatggccatctggaa
gaacgtattcacttcgatagcacttcaagcctgtttcggcttggcgtcgccttcaaccgc
atggccgataacctgaaccagctcatcaacagtaaaaaacagctgattgataatattgca
cacgagctgcgtacgccgctggtcaggctgcgctatcggctggccatgagcgacaatctg
acggaagacgagcagcaggcgctaaaccgggatattggtcagcttgaagcactgattgac
gagctgctgacctatgcccgactcgaccgtccgcaggtgacgttgcaccttgccaatatc
gatattccttcgtggttacaggcaaaagtcgacgattttcgtctgatccaccctgacaaa
catatttcgttggatatgccccattcagcacagattggcgcactcgatttgcgcctgatg
gaacgggttctgaataacctgatcggtaacgggttacgcttctgccatagccgattacac
atcagcctgacgtccgacgccgagcatatcgcctgtctacaagtcgaagatgacggcccc
ggtattgcgcccgaaagccgggaaagcgtgtttgaaccgtttatccgtctggaagcgggt
atcgagaacagcagcggcgggtgtgggctcgggctggccattgttaatgctatcgcccgc
gcctacgaaggcagtattaccgtggatgaaagcccgctcggcggcgctcgtttccgcttt
tgttggccagtaaaaaccacgacagcgcagacgaccatcgccatccagcactag

DBGET integrated database retrieval system