KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2371Help
Entry
PC1_2371          CDS       T00934                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00740  Riboflavin metabolism
pct00790  Folate biosynthesis
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct02024  Quorum sensing
Module
pct_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PC1_2371
   00790 Folate biosynthesis
    PC1_2371
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PC1_2371
Enzymes [BR:pct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PC1_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACT13402
UniProt: C6DK19
Position
2727033..2727626
Genome map
AA seq 197 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEEIATGHDHLALVYGDISGSVPVLARVHSECLTGDAL
FSLRCDCGFQLEAALGHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDLGADTVEANHQ
LGFAADERDFTLCADMFKLLDVDEVRLLTNNPQKVKILNEAGINIVERVPLIVGRNPKNE
NYLATKAAKMGHMLDMK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaaaacgggtggcggaagccaagttacccaccccgtggggcgatttcctgatg
gtcggtttcgaagagatcgccacaggtcacgatcacctcgctttggtttatggtgatatt
tccggttcagttcccgtacttgcccgtgtgcattccgaatgtctgacaggggatgcatta
tttagtctgcgctgtgactgtggtttccagcttgaggccgcattgggccatatcgccgaa
gaaggtcgcggcgtgctgttataccaccgccaggaaggccgaaatatcgggttactgaat
aaaatccgtgcctatgcgttgcaggatctgggcgctgatacggtagaggccaatcatcag
cttgggtttgccgccgatgagcgtgatttcacgctgtgcgccgacatgttcaaactgttg
gatgttgatgaagttcgcctgctgaccaataatccgcagaaagtgaaaatcctcaacgaa
gctgggatcaatatcgtcgaacgcgtgccattaatcgtcggacgcaacccgaagaatgag
aactatctggcaaccaaagctgccaaaatggggcacatgctggatatgaaataa

DBGET integrated database retrieval system