KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2375Help
Entry
PC1_2375          CDS       T00934                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00480  Glutathione metabolism
pct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PC1_2375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pct02000]
    PC1_2375
Enzymes [BR:pct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PC1_2375
Transporters [BR:pct02000]
 Other transporters
  Pores ion channels [TC:1]
   PC1_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_2 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ACT13406
UniProt: C6DK23
Position
2734737..2735345
Genome map
AA seq 202 aa AA seqDB search
MKLFYQAESSSLFTHIVLIESKLEFKLEKVNLRTKKTERGTDYTFINPKGMVPALELDDG
SILTEGVAIAEYIADLVPHCNLIAPTGSMARYHTLEWLNYISAELHKTFTPIFRPGTPET
YKELLMEYLQVKFRYINLVLSEQNYLVANRFSIADAYLFTVMRWAQSLKLDMFRYPALAA
YLDHIAERPSVATALKVERLKG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttatcaagctgaaagcagttctctttttacacacatcgttttgatcgaa
tccaaactggagttcaagctggagaaggttaatctgcgcacgaaaaaaacagagcgtgga
accgactatacgttcatcaacccaaaagggatggtgccagcgttagagctagatgatggt
tctatcctgactgagggtgttgccatcgctgagtacattgccgatctagttccgcactgt
aaccttatcgcccccaccggcagcatggcacgctaccatactctcgaatggctgaattac
atttctgctgagctgcacaaaacgtttacaccgatcttccgtcctggtacgccggagacg
tataaagagctgctaatggaatatttgcaggtcaaattccgttatatcaatttggtgtta
agtgagcagaattatttagtcgccaaccgtttcagtatcgccgatgcgtatctgtttacc
gtgatgcgctgggcacagtcgctaaaactggatatgttccgctaccctgcgctggcggct
tacctcgaccatattgccgaacgtccttccgtcgcgaccgcgcttaaggttgaaaggttg
aaaggttga

DBGET integrated database retrieval system