KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2771
Entry
PC1_2771          CDS       T00934                                 

Definition
(GenBank) NADH-quinone oxidoreductase, B subunit
  KO
K00331  NADH-quinone oxidoreductase subunit B [EC:7.1.1.2]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00190  Oxidative phosphorylation
pct01100  Metabolic pathways
Module
pct_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pct00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PC1_2771
Enzymes [BR:pct01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     PC1_2771
SSDB
Motif
Pfam: Oxidored_q6
Other DBs
NCBI-ProteinID: ACT13801
UniProt: C6DA45
Position
complement(3144543..3145217)
AA seq 224 aa
MDYTLTRIEPDGENDRYPLQRQEIVSDPLEQHVHRSVYMGKLEHALHDTVNWGRQNSLWP
YNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQ
MLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYIPGCPPRPEAYMQALLLLKESI
GKERRPLSWVVGEQGVYRANMQSERERKRGERIAVTNLRSPDEI
NT seq 675 nt   +upstreamnt  +downstreamnt
atggactatacgctcacccgcatagagccggacggtgagaatgaccgttatcccctgcaa
cgtcaggagatcgtttccgaccctctggagcaacatgttcaccgcagtgtctacatgggc
aaactggaacatgcgttacacgatacggtgaactgggggcgtcagaactccctgtggccg
tacaacttcggcctttcctgttgctacgtagaaatggtgacgtcatttacggcggttcat
gacgtggcgcgttttggtgctgaggttctgcgtgcatcgccacgtcaggctgacttcatg
gtcgtagcgggaacctgttttaccaaaatggcccccgttattcagcgtctgtacgagcaa
atgcttgagcctaaatgggttatctccatgggcgcctgtgctaactccggtggtatgtac
gatatctattccgtcgttcagggcgtagataaattcctgcctgttgatgtgtatattcca
ggctgccctccgcgtcctgaagcctacatgcaagcgctgttgctgctgaaagaatccatc
ggtaaagaacgccgccctctgtcatgggtggtaggtgaacagggcgtttaccgtgccaat
atgcaatctgagcgtgaacgcaaacgcggcgagcgaatcgctgtgaccaacctgcgctcg
cctgatgagatttga

DBGET integrated database retrieval system