KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2774Help
Entry
PC1_2774          CDS       T00934                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00220  Arginine biosynthesis
pct00250  Alanine, aspartate and glutamate metabolism
pct00290  Valine, leucine and isoleucine biosynthesis
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01130  Biosynthesis of antibiotics
pct01210  2-Oxocarboxylic acid metabolism
pct01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PC1_2774
   00290 Valine, leucine and isoleucine biosynthesis
    PC1_2774
   00220 Arginine biosynthesis
    PC1_2774
Enzymes [BR:pct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PC1_2774
    2.6.1.66  valine---pyruvate transaminase
     PC1_2774
Amino acid related enzymes [BR:pct01007]
 Aminotransferase (transaminase)
  Class I
   PC1_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACT13804
UniProt: C6DA48
Position
3147805..3149019
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSKKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQHYQARDMRDITVEDVYIGNGVSELIVQSMQALLNPGD
EMLVPAPDYPLWTAAVSLSNGNAVHYLCDESSDWFPDLDDIRKKITSNTRGIVIINPNNP
TGAVYSKELLLDIVAIAREHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRNRSWELINQIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKLVLDLLLQEK
VLLVQGTAFNWPYPDHVRIVTLPRIDELDMAIHKLGRFLGHYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgattgaaaaatccaagaaactggagaacgtatgctatgacatccgtggccca
gtcttaaaggaagccaaacggcttgaagaagaaggtaataaagtccttaagctgaatatt
ggtaacccagctccttttggcttcgaggcaccggacgagattctggtcgatgtcatccgt
aacctgcccacggcacagggctactgtgattccaaaggcctctattccgcccgcaaagcc
atcgttcagcattatcaggcgcgggatatgcgcgatattacggttgaagatgtctacatt
ggtaacggtgtgtccgagctcatcgtgcaatccatgcaggcactgcttaacccaggcgat
gaaatgctggttcctgcgccggactacccactttggaccgcagccgtttctctgtctaac
ggcaacgccgttcactacctctgcgatgagtcctccgattggttccccgacctggatgat
atccgtaaaaagatcacgtccaatactcgcggtattgtcattatcaacccgaacaatcca
acgggcgcggtctacagtaaagagttgctgctggatatcgtggcgattgcacgcgaacat
aacctgatcatcttcgctgacgaaatttacgacaaaattctgtatgacgatgcacagcat
cactcgattgccgcactcgcgccggacctgctgacggtcacattcaacggcctgtccaaa
acgtaccgtgtagcaggtttccgtcaaggctggatggtactgaacggtccgaaaaaacac
gccaaaggctatattgaagggctggaaatgctggcttccatgcgtctgtgcgctaatgtg
ccaatgcagcatgcgattcagactgcgctgggcggctatcagagcatcagcgaatttatt
cagcccggcggacgcctgtacgagcagcgcaaccgttcctgggaactgatcaatcagatt
cccggcgtatcatgcgtaaaaccgcgcggcgcgctgtatatgttcccacgcattgatgcc
aaacgctttaatatccatgacgaccaaaaactggtgctggatctcctgttacaggaaaaa
gtgttgctggttcagggaaccgcatttaactggccttacccagaccatgttcgcatcgtc
acgctgccgcgtatcgatgagctggatatggcaatccacaaattagggcgtttcttgggg
cactatcaccagtaa

DBGET integrated database retrieval system