KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3255
Entry
PC1_3255          CDS       T00934                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
KEGG Orthology (KO) [BR:pct00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pct02044]
    PC1_3255
Secretion system [BR:pct02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PC1_3255
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACT14275
UniProt: C6DCV0
Position
complement(3671740..3672243)
AA seq 167 aa
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSI
DKNNFTSVMKEAELELNFSVPNRLEEESQDDLPVKLSIGGLNDFSPDRIAQQVPELRKLL
DLREALVALKGPLGNIPSFRNRLQDLLSSEEAREQLLKELDLVKPAE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcaaaaggaactgacggtgcatctgtcgcaccaaaggaacgtattaatatcaaatat
gttccagccactggtggtcagcaggcggaaatagaattgccgttgacgctgatgatcgtg
ggaaatatgaaagggcgcacagaggaaacgccgatcgaagaacgtcagaccgtctcgatc
gacaagaacaactttacctcggtgatgaaagaagcagagctggaactgaatttcagtgtg
ccaaaccgccttgaagaagaaagccaggatgacctgccagtgaaactgagcatcggcggt
ctgaatgatttctcccctgaccgtatcgcccaacaggtgcctgagttgcgtaagttgctt
gatttacgtgaggcgctggttgcgctgaaaggccccctcggcaatattccctcattccgt
aatcgtttgcaggatctgttgtccagcgaagaagccagagagcagcttttgaaagagctc
gatctggtaaaacccgccgaataa

DBGET integrated database retrieval system