KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3284Help
Entry
PC1_3284          CDS       T00934                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00330  Arginine and proline metabolism
pct00332  Carbapenem biosynthesis
pct01100  Metabolic pathways
pct01130  Biosynthesis of antibiotics
pct01230  Biosynthesis of amino acids
Module
pct_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PC1_3284
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PC1_3284
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PC1_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ADC
Motif
Other DBs
NCBI-ProteinID: ACT14300
UniProt: C6DCX5
Position
complement(3699091..3700194)
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIATKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
MRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILADADKLLLLTDQAGLFTADPR
NNPDAELIREVNGINDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDVVIAAGSKPG
VIGDVIADISVGTRFHAVDAPLESRKHWIFGAPPAGEITVDDGALSAILERGSSLLPKGI
RRVEGNFSRGEVIRVRSLAGRDVAHAVTRYNSDALRMIAGHHSQQIAEILGYEYGPVAIH
RDDMIIN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcagccagactttggttgtgaaactgggcaccagcgtgctaaccggcggttcg
cgccgtcttaaccgcgcccacattgttgaactggtgcgccagtgcgcgcagcaacatgcg
gcagggcatcggattgttattgtcacctcaggagcgattgctgccgggcgtgaacatttg
ggttaccccgaactccccgccacgattgcgaccaaacaactactggccgccgtgggtcaa
agccgcctgattcagctgtgggaacagctgttttccatctacggtatccacgttgggcaa
atgctgctgacgcgtgcggatatggaagatcgtgagcgtttcctcaacgcgcgcgacacc
atgcgggcgctgctggataacaatattgttccggtcattaatgaaaacgacgccgttgcg
accgccgagatcaaggtgggtgacaacgacaacctgtctgcgctggcggcgattctggcc
gatgcggataagctgctgctgctgaccgatcaggccgggttgtttaccgccgatccgcgc
aataatcctgatgcggagctgattcgtgaagtgaacggcatcaatgatgcgctacgcagc
attgcgggtgacagcgtgtcaggcctcggaacgggcggtatgtcgactaaattgcaggct
gccgatgtggcctgtcgtgctggtatcgacgtggtgatcgccgcaggcagcaaaccaggt
gtgattggcgatgtcattgcagatatctccgttggaacgcgttttcatgccgtggatgcg
ccgctggaaagccgtaaacactggatttttggtgcgccacctgcaggggaaatcaccgtc
gacgacggcgcgctttcggcgatccttgaacgcggcagctcgctgctgccgaagggcatt
cgccgtgtggaagggaatttctctcgcggtgaagtgatccgcgtgcgcagcttggcgggc
cgcgatgtggcgcacgccgtgacgcgttataacagcgatgcgctgcgtatgattgccgga
caccactctcaacagattgccgagattcttggctacgaatatggtccggtggctatccat
cgcgacgatatgattatcaattaa

DBGET integrated database retrieval system