KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3350Help
Entry
PC1_3350          CDS       T00934                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
Enzymes [BR:pct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PC1_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_11 Methyltransf_23 NodS CMAS Methyltransf_32 DREV
Motif
Other DBs
NCBI-ProteinID: ACT14366
UniProt: C6DDF9
Position
complement(3778975..3779601)
Genome map
AA seq 208 aa AA seqDB search
MVNKRIETLLAQLRQQGIQDERLLKAIEAVPRERFVDEAFEHKAYENTALPIGSGQTISQ
PYMVAKMTELLSLTPVSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWASRGPFDAIIVTAAPPEIPRALLEQLDEGGVMVLPVGEQSQILQ
VVQRHAGEFIIQTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaagcgtatagaaacgttgctggcacagttgcgccagcaaggcattcaggac
gaacgtctgctgaaggcgatagaagccgtacccagagaacgttttgttgatgaagctttt
gaacataaagcgtatgaaaacaccgctctgcctattggttccggccagactatctcgcag
ccctatatggtcgcgaagatgacggagctgctcagcctgacgcccgtatcccgcgtgctg
gaaattggcacggggtcaggttatcaaacggcgattttagcgcatttggttcaacacgtt
tgctcggtcgagcgcattaaggggctgcaatggcaggccaagcgccgcttaaagcagctt
gatttgcataatgtttctacccgtcatggcgatggatggcaaggctgggcgtcgcgcggg
ccgtttgacgctattatcgttaccgccgcaccgccggaaattcctcgggcactgctggaa
cagctcgatgaaggtggcgtaatggtgctgcccgtcggggaacagtcgcaaatactgcaa
gttgtacagcgccatgctggcgaatttattattcaaacggttgaagctgttcggtttgtt
cctctggtcaaaggggagttagcctga

DBGET integrated database retrieval system