KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3681Help
Entry
PC1_3681          CDS       T00934                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N DUF2231 Semialdhyde_dh TrkA_N LD_cluster2
Motif
Other DBs
NCBI-ProteinID: ACT14696
UniProt: C6DF32
Position
4155105..4156106
Genome map
AA seq 333 aa AA seqDB search
MTVHAIAVDPQQPENFIAITQDIPEPGEYDLLIDVKAISVNPVDTKVHAGLRQNGLQQPR
ILGWDASGVVLKTGSAVSQFRVGDEVWYAGDITRPGSNTTHQLIDSRIVAHKPASLDWAA
AAAMPLTALTAWEGLFEHLKIQQADSEKTLLIIGGAGGVGSLAISLAALRSSVNIIATAS
KPDSAEWCRQRGAHKVVDYRNLVAELEKEGIKQVDYIFCLNDTDGHWEAISKLIAPMGHI
CTIVENKNPLDQTALKLKSAALHWELMFTRSMFTTPDIAEQGNILHEVAQLVDAGKLQGT
ASETLQGLTVDTLKQAHDKVLEGHMRGKIVIAL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcatgcgatagccgttgatccacaacagccagaaaatttcatcgccatcacc
caagacatccccgagcccggtgaatacgatctgttaatcgacgtaaaagccatttccgtc
aacccggtggataccaaggtgcatgccggattgcgccagaatggattacagcagcctaga
attctcggctgggatgccagcggcgtcgtgctgaaaacaggcagcgccgttagccagttt
cgggtaggcgatgaagtctggtacgccggtgatatcacccgtcccggcagcaacacgaca
catcagttaattgattcacgcatcgtcgcacacaagcccgcgtctctcgactgggccgca
gcggctgccatgccgctcacggcgctgacagcgtgggaagggctgttcgagcacttgaaa
atacagcaggctgacagcgagaaaacgctgctgattatcggtggtgcaggcggcgtaggc
tcccttgcgatttctctggcagcgctgcgcagttcagtgaacattatcgctactgcatca
aagcctgactcggcggaatggtgccgccagcgtggcgcacacaaggtcgtggattaccgt
aatttggtggctgagctagaaaaagaagggatcaaacaggtcgattacattttctgtttg
aacgataccgacggccactgggaggcgatcagcaagctgatcgcaccgatggggcatatc
tgtaccatcgtggaaaacaaaaacccgctcgaccaaacggcgctgaaactcaaaagcgcg
gcgctacattgggaactcatgtttacccgcagcatgtttaccacaccggatatcgccgaa
caggggaacattttgcacgaagtcgcacagctggttgatgctggaaaacttcagggaacc
gccagcgaaacgctgcaagggttaacggtagacacgctgaagcaagctcacgataaagtg
ctggaagggcatatgcgcggcaagatcgttatcgcgctgtaa

DBGET integrated database retrieval system