KEGG   Candidatus Protochlamydia amoebophila: pc0008Help
Entry
pc0008            CDS       T00172                                 

Gene name
recC
Definition
(GenBank) putative exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    pc0008 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcu03400]
    pc0008 (recC)
Enzymes [BR:pcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     pc0008 (recC)
DNA repair and recombination proteins [BR:pcu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     pc0008 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: CAF22732
UniProt: Q6MFB7
Position
11759..15346
Genome map
AA seq 1195 aa AA seqDB search
MFLLKFYVGFNKTVCKEGCKLLTLTVDTPKSEPFVSDLEVFFSNQLSILYEQLKNNLFGF
KQTPFKKRLVIVYGPAMQTWLTLKMAQDPDLGIAAGIEFLYLNQAFETLIHYFQLKNEKI
PSILELSLAIEKELLTVLQDYHRLSDEEQQDWLTLIYYLKLNSKQVGENLKLTRKMEKRL
TGLSYHLAKIFQEYGKYAYSLVSKWEKSEHRGWQSRLWKSLFGGNQGWTYWTKAFQKTLK
FFPECEVHFFSISFISKAEFQFLSKLANVAPIYYYLLSPCAVFWSDIRSDNETRYLQTYW
QQKLGSKASQVLQLEELLRDRNPLLANFGKLGREMAYQIEESQATTHAGYILPSHVSELN
DEIFFQEDLFLKESLQPLTLLHAIQADILMMRNPEGKPPFNFERKDDSIQLHIAPSIRRE
IQILYHNLLKLFEKDSTLQPNDIIVMAPQISDYVPYIQSVFGLEESQLDFQILDLGMQAQ
SEIVQGFFQLIRLSESRWEVSELLQLFGHRLFQRCHQLTQSDYYLIQEWIQQAGIRWGED
WLHRNELLQRHHCEKEMVDSSSVGTWNFGLTRLLLGLTTVVKSADSHSFDSIPCEGIDFS
QAELMERWIRLLHSLRDDLSPLHDRSQMCMEEWSCYLSCLLDTYFKCEFEDSQSIADYEE
LKSQFKLLGDSAKTFKETKFSFQTIKFHLNNLLQQRGITYRESHLQTIRFCSMMPLRSIP
AKVIAVLGMQEGAFPRAGYHTSLNLMVGQDNLDYNPNSTDYDRYLFLEALQSVTDVFIVS
YQGYTYQDSKVLQPSLIIEEFFTYLDKYYLIQNKKISEQCVSKHPFDAFDVSYFKPNSIL
NNYSQFDYRIAEQYYQTHKTPSHRLLKQFILSNYSLEDILPSHTVIDLKTLNTLVRSPVK
FYLNRGLDIYLEGYEDRIIKNQEELGLSALNKYQLKQFALKEPFEKVMQIADKEGKLPLG
MFKTVATKRFKDEIDEVHQRLYKHGINPSELFQIEFCTSCSEPCQIQKDQWLLPALQLNY
SDQYQISIIGKLPFVSKKGLVVLSQGSGFSDAWKAWPQFLLFNYATTFNIEAIERNLILS
KSSEVKKAFFKDSIPYLKHLINYYALSMRNFSPLFPDWIPSLIEGDEQAIQNYMKQVFSN
SFGAFLNQELRWVFNKDHLPCPKILIESWQEIGKQLAGDLIQLWYPPKKKKGEDA
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgctaaaattttatgttggattcaacaaaactgtatgcaaggaaggatgtaaa
cttctaaccctaacagttgatacaccaaaaagtgagccctttgtgagcgatttagaagtt
ttttttagtaaccagctatcaatcctctacgagcagctgaagaataatcttttcggtttt
aagcaaacgcctttcaaaaagcgacttgtgattgtttatggaccagccatgcaaacatgg
ctaactttaaaaatggcgcaagaccctgatttaggaatagcagctggaattgaatttcta
tatcttaatcaggcttttgaaacactcattcactattttcaattaaaaaatgaaaagata
ccttctattttagagctatctttggccattgaaaaagaattattaactgttttgcaagat
tatcatcggttaagtgatgaagaacaacaagactggttaactttgatttattatttaaaa
ttaaattctaagcaggtgggcgaaaatcttaaattaacacgtaaaatggaaaagcgattg
acaggtttaagctatcatttagctaaaatttttcaagagtatggaaaatatgcttattca
ttagtctctaaatgggaaaaatcagaacatagaggttggcagagtcgtttatggaaaagc
ctttttgggggcaatcaaggatggacttattggactaaagccttccaaaaaacacttaaa
ttttttcctgagtgtgaagtccattttttctcaatcagttttatttctaaagctgaattt
caatttttatcgaagctggcgaatgttgcccctatttactattatttactttctccatgc
gcagttttttggagtgatattcgttccgataacgagacaagatatttgcaaacctactgg
cagcagaaattaggctcgaaggcttctcaagttttacaattagaagaacttttaagagat
cgaaatccccttttagctaattttggaaaacttggaagagaaatggcttatcaaattgag
gagagtcaagctactactcacgctggttatatccttccaagtcatgtgagtgaattgaat
gatgaaatattttttcaagaagatctttttttaaaggagtctttacaacctttgactctt
cttcatgcaattcaagctgatatattgatgatgcgtaaccctgaaggaaagcctcctttt
aattttgaacgaaaagatgattcaatccaattgcacattgctccctcgattcgacgtgaa
atacaaatcctttatcacaatcttttaaaattatttgaaaaagattctactttgcaaccc
aatgacattattgtgatggctcctcaaatttctgattacgtcccttacattcaaagtgtt
tttggtttagaagaaagtcaattagattttcaaattcttgatttgggcatgcaagcacaa
agtgaaatcgtccaaggttttttccaattgattcggttaagtgaaagtcgttgggaagtg
agtgaattattacagttgtttgggcaccgtctatttcaacgatgtcatcaattgactcaa
agtgattattatctcattcaagaatggattcaacaagcaggcatccgttggggagaagat
tggctacatcgaaatgagttacttcagaggcatcattgtgagaaagagatggtagattct
agctcagttggaacctggaattttggtttaactcgtttgttacttggattaacaacagtt
gtcaaatctgccgattctcattcttttgattctattccatgtgaaggaattgacttttct
caagcagaattaatggagaggtggattcgattgttgcattctttacgagatgatttatcg
ccattacatgatcgctctcaaatgtgtatggaagaatggtcttgttatctctcttgttta
ttagacacttattttaagtgtgaatttgaagattctcagtcgatagcagactacgaagaa
ttaaaatctcaatttaagcttttaggtgattctgcaaaaacttttaaagaaacaaaattt
tctttccaaactattaaatttcatttgaacaatcttttacaacaaagaggaattacttat
cgagaaagccacctgcaaaccatccgattttgttccatgatgcctcttcgttctattcct
gccaaagtaatcgcagtactaggaatgcaagaaggagcttttccccgcgcaggctatcat
acttcattgaatttaatggttgggcaagacaatcttgactataacccaaactctacagat
tatgatcgttatttatttttagaggctcttcaatctgttacagacgttttcatcgttagt
tatcaaggatatacctaccaagattccaaagtattgcagccaagtttgattattgaagag
tttttcacctatttggataaatattatctcattcaaaataaaaaaatttctgaacaatgt
gtaagtaaacatccatttgatgcatttgacgtctcttatttcaaaccaaattctatttta
aataattactcacaattcgactatagaattgctgaacaatactaccaaactcataaaact
ccttctcatcgattacttaaacaatttattttaagtaactactctcttgaagatatcctt
ccttctcacacagtgattgatttaaaaactttaaatacgttagttcgctcacctgttaaa
ttttatttgaatagagggttagacatttatttggagggctatgaagatcggattattaaa
aaccaagaagagcttggattatcagccttaaataaatatcagctcaaacaatttgcatta
aaggaaccatttgaaaaagtgatgcagattgcagataaagaaggaaaacttcctttggga
atgttcaaaacagttgcgacaaaacgtttcaaagatgaaatagatgaagtgcatcaaaga
ttgtataaacatggtattaatccttccgaactttttcaaatcgaattttgtactagttgt
tccgaaccttgccaaattcaaaaagatcaatggttacttccagctcttcaactgaattat
tctgatcaatatcaaatttctataattggaaagttgccctttgtttctaaaaaaggcctt
gttgttttaagtcaaggaagtggattttcagatgcttggaaagcatggccccaatttctg
ctttttaattatgctacaacttttaatattgaggcgattgaaagaaaccttattctttca
aaatcttcagaggtcaaaaaggctttttttaaagatagcattccttatttaaagcatttg
attaattattatgcactatctatgcgcaatttttctccgctctttcctgattggattcct
tcccttattgaaggggatgaacaggcaattcaaaattacatgaaacaggtcttttcaaat
tcttttggagcttttttaaatcaagaattaaggtgggtttttaataaagaccatctacct
tgcccgaaaattttaatcgaatcttggcaagagatcggtaaacaactagccggagatttg
attcaattatggtatcctcctaaaaagaagaaaggggaagatgcatga

DBGET integrated database retrieval system